Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN183176

Cation Channel, Sperm Associated 2 (CATSPER2) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms CATSPER2
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB), Immunohistochemistry (IHC)
Pubmed 1 reference available
Catalog no. ABIN183176
Quantity 100 µg
Price
229.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-CATSPER2 antibody: synthetic peptide directed towards the N terminal of human CATSPER2
Sequence HLQGLSQAVPRHTIRELLDPSRQKKLVLGDQHQLVRFSIK PQRIEQISHA
Predicted Reactivity Human : 100%, Rabbit : 100%, Horse : 92%, Pig : 92%, Bovine : 84%
Characteristics This is a rabbit polyclonal antibody against CATSPER2. It was validated on Western Blot and immunohistochemistry. We manufacture rabbit polyclonal antibodies on a large scale of high throughput manner. Our antibodies are peptide based and protein family oriented.
Purification Protein A purified
Alternative Name CATSPER2
Background Calcium ions play a primary role in the regulation of sperm motility. Anti-CATSPER2 belongs to a family of putative cation channels that are specific to spermatozoa and localize to the flagellum. The protein family features a single repeat with six membrane-spanning segments and a predicted calcium-selective pore region. A second, closely linked copy of this gene has been identified. Although multiple transcript variants encoding protein isoforms have been characterized, they seem to be only transcribed from this gene. Additional splice variants have been described but their full-length nature has not been determined.
Molecular Weight 46kDa
Gene ID 117155
NCBI Accession NP_742094, NM_172096
UniProt Q96P54
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-CATSPER2 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Quill, Ren, Clapham et al.: "A voltage-gated ion channel expressed specifically in spermatozoa." in: Proceedings of the National Academy of Sciences of the United States of America, Vol. 98, Issue 22, pp. 12527-31, 2001 (PubMed).

Alternatives for antigen "Cation Channel, Sperm Associated 2 (CATSPER2)", type "Antibodies"
Hosts (24)
Reactivities (21), (14), (14), (13), (13), (12)
Applications (15), (10), (3), (3), (3)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (6), (3), (3)
Beacon