High Mobility Group Box 3 (HMGB3) antibody

Antigen: High Mobility Group Box 3 (HMGB3)

Synonyms: HMG4, HMG2A, MGC90319, Hmg4, Hmg2a, RGD1564407, hmgb3, MGC54022, Xhmgb3, MGC88931, HMGB3, fa19b06, fj43d02, wu:fa19b06, wu:fj43d02, zgc:112073, MGC133786, HIGH MOBILITY GROUP B 3, NFD03, NFD3, NUCLEOSOME/CHROMATIN ASSEMBLY FACTOR

Clonality: Polyclonal

Host: Rabbit

Reactivity: Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Xenopus laevis, Chicken, Zebrafish

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Catalog no.: ABIN183219

Additional Information

Alternative name: HMGB3

Gene ID: HMGB3

UniProt: O15347

Immunogen: The immunogen for anti-HMGB3 antibody: synthetic peptide directed towards the C terminal of human HMGB3

Sequence: NLNDSEKQPYITKAAKLKEKYEKDVADYKSKGKFDGAKGP AKVARKKVEE

Cross-Reactivity: Cow (Bovine), Dog (Canine), Chicken, Human, Mouse (Murine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 100 µl of distilled water. Final anti-HMGB3 antibody concentration is 1 mg/ml.

Description: The human HMG2a gene is transcribed mainly in the placenta. HMG2a encodes a protein which is part of the high mobility group (HMG) family. Members of this family are ubiquitously expressed and facilitate the formation of nucleoprotein complexes where the DNA is sharply bent.

Characteristics: Antigen Size: 200 amino acids

Molecular Weight: 23kDa

Synonyms: HMG4, HMG2A, MGC90319, Hmg4, Hmg2a, RGD1564407, hmgb3, MGC54022, Xhmgb3, MGC88931, HMGB3, fa19b06, fj43d02, wu:fa19b06, wu:fj43d02, zgc:112073, MGC133786, HIGH MOBILITY GROUP B 3, NFD03, NFD3, NUCLEOSOME/CHROMATIN ASSEMBLY FACTOR

Application Details

Application Notes: WB Suggested Anti-HMGB3 Antibody Titration: 0.3ug/ml
ELISA Titer: 1:312500
Positive Control: Human Placenta.

Purification: Protein A purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Restrictions: For Research Use only

Images

WB Suggested Anti-HMGB3 Antibody Titration: 0.3ug/ml
ELISA Titer: 1:312500
Positive Control: Human Placenta

anti-High Mobility Group Box 3 (HMGB3) antibody (Image 2)

Publications

Product: Vaccari, Beltrame, Ferrari et al.: "Hmg4, a new member of the Hmg1/2 gene family." in: Genomics, Vol. 49, Issue 2, pp. 247-52, 1998 (PubMed).