Add to Basket Bulk discount
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

Zinc Finger Protein 266 (ZNF266) antibody

Antigen

Zinc Finger Protein 266 (ZNF266)

Synonyms ZNF266, ZNF426
Clonality Polyclonal
Host
Alternatives

Rabbit

Reactivity
Alternatives

Human

Conjugate
Alternatives Un-conjugated
Application
Alternatives Western Blotting (WB), Immunohistochemistry (IHC)
1 reference available
Catalog no. ABIN183228
Quantity 50 µg  (Variants)
Price 317.90 $   Plus shipping costs $45.00
Bulk discount
Shipping to
Availability Will be delivered in 2 to 3 Business Days

Additional Information

Alternative name ZNF266
Gene ID ZNF266
UniProt Q14584
Immunogen The immunogen for anti-ZNF266 antibody: synthetic peptide directed towards the N terminal of human ZNF266
Sequence EESRTVQRGDFQASEWKVQLKTKELALQQDVLGEPTSSGI QMIGSHNGGE
Cross-Reactivity Human
Format Lyophilized
Reconstitution Add 50 µl of distilled water. Final anti-ZNF266 antibody concentration is 1 mg/ml.
Description Located on chromosome 19, ZNF266 is part of the Kruppel-related zinc finger gene family.
Characteristics Antigen Size: 549 amino acids
Molecular Weight 62kDa

Application Details

Application Notes WB Suggested Anti-ZNF266 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: HepG2 cell lysate.
Purification Affinity Purified
Buffer PBS
Storage (Long Term) For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Storage (Short Term) Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.
Research Area Chromatin and Nuclear Signaling, Transcription Factors
Restrictions For Research Use only

Publications

Product Abrink, Aveskogh, Hellman: "Isolation of cDNA clones for 42 different Krüppel-related zinc finger proteins expressed in the human monoblast cell line U-937." in: DNA and cell biology, Vol. 14, Issue 2, pp. 125-36, 1995 (PubMed).

Alternatives

Alternatives for antigen "Zinc Finger Protein 266 (ZNF266)", type "Antibodies"
Hosts Rabbit (33), Mouse (2)
Reactivities Human (35), Mouse (Murine) (3), Rat (Rattus) (2), Cat (Feline) (1), Chicken (1), Cow (Bovine) (1), Dog (Canine) (1)
Applications Western Blotting (WB) (20), Immunofluorescence (IF) (16), ELISA (11), Immunohistochemistry (IHC) (8), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) (4), Immunohistochemistry (Formalin-fixed Sections) (IHC (f)) (3), Immunoelectron Microscopy (IEM) (1), Immunoprecipitation (IP) (1)
Conjugates Alexa Fluor 350 (1), Alexa Fluor 488 (1), Alexa Fluor 555 (1), Alexa Fluor 647 (1), Biotin (1), Cy3 (1), Cy5 (1), Cy5.5 (1), Cy7 (1), FITC (1), Gold (1), HRP (1), PE (1), PE-Cy3 (1), PE-Cy5 (1), PE-Cy5.5 (1), PE-Cy7 (1)
Epitopes N-Term (2), Internal Region (1)