Add to Basket Bulk discount
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

Zinc Finger and BTB Domain Containing 44 (ZBTB44) antibody

Antigen

Zinc Finger and BTB Domain Containing 44 (ZBTB44)

Synonyms BTBD15, ZNF851, HSPC063, MGC26123, MGC57431, MGC60348, MGC88058, btbd15, hspc063, MGC145247
Clonality Polyclonal
Host
Alternatives

Rabbit

Reactivity
Alternatives

Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Dog (Canine)

Application
Alternatives Western Blotting (WB)
1 reference available
Catalog no. ABIN183241
Quantity 50 µg  (Variants)
Price 317.90 $   Plus shipping costs $45.00
Bulk discount
Shipping to
Availability Will be delivered in 2 to 3 Business Days

Additional Information

Alternative name BTBD15 / ZBTB44
Gene ID BTBD15
UniProt Q86XX5
Immunogen The immunogen for anti-BTBD15 antibody: synthetic peptide directed towards the C terminal of human BTBD15
Sequence PVDSSLAFPWTFPFGIDRRIQPEKVKQAENTRTLELPGPS ETGRRMADYV
Cross-Reactivity Cow (Bovine), Dog (Canine), Human, Mouse (Murine), Rat (Rattus)
Format Lyophilized
Reconstitution Add 50 µl of distilled water. Final anti-BTBD15 antibody concentration is 1 mg/ml.
Description Located on chromosome 11, the BTBD15 gene encodes a BTB (POZ) domain containing 15 protein with unknown function.
Characteristics Antigen Size: 467 amino acids
Molecular Weight 52kDa

Application Details

Application Notes WB Suggested Anti-BTBD15 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: HepG2 cell lysate.
Purification Affinity Purified
Buffer PBS
Storage (Long Term) For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Storage (Short Term) Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.
Restrictions For Research Use only

Publications

Product Strausberg, Feingold, Grouse et al.: "Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences." in: Proceedings of the National Academy of Sciences of the United States of America, Vol. 99, Issue 26, pp. 16899-903, 2002 (PubMed).

Alternatives

Alternatives for antigen "Zinc Finger and BTB Domain Containing 44 (ZBTB44)", type "Antibodies"
Hosts Rabbit (7)
Reactivities Human (6), Rat (Rattus) (3), Chicken (1), Cow (Bovine) (1), Dog (Canine) (1), Mouse (Murine) (1), Xenopus laevis (1)
Applications Western Blotting (WB) (7), ELISA (1)
Epitopes N-Term (2), C-Term (1), C-Term,AA 424-453 (1), Internal Region (1)