Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN183259

Zinc Finger Protein 695 (ZNF695) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms RP11-551G24.1, SBZF3
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN183259
Quantity 100 µg
Price
229.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-SBZF3 antibody: synthetic peptide directed towards the N terminal of human SBZF3
Sequence FNMQFLFHSLAMSKPELIICLEARKEPWNVNTEKTAKHSA LSSYLTEDIL
Predicted Reactivity Human :100%,  
Characteristics This is a rabbit polyclonal antibody against SBZF3. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Protein A purified
Alternative Name SBZF3
Background SBZF3, located on chromosome 1, encodes a zinc finger protein.
Molecular Weight 54kDa
Gene ID 57116
UniProt Q9HD74
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-SBZF3 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Strausberg, Feingold, Grouse et al.: "Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences." in: Proceedings of the National Academy of Sciences of the United States of America, Vol. 99, Issue 26, pp. 16899-903, 2002 (PubMed).

Alternatives for antigen "Zinc Finger Protein 695 (ZNF695)", type "Antibodies"
Hosts (6), (2)
Reactivities (8)
Applications (8), (2), (1)
Epitopes (2), (2), (1), (1), (1), (1)
Beacon