Zinc Finger Protein 695 (ZNF695) (N-Term) antibody

Details for Product No. ABIN183259
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

 
Antigen
Synonyms RP11-551G24.1, SBZF3
Epitope
N-Term
(2), (2), (2), (1), (1), (1)
Reactivity
Human
(10)
Host
Rabbit
(8), (2)
Clonality
Polyclonal
Application
Western Blotting (WB)
(10), (3), (2)
Pubmed 1 reference available
Catalog no. ABIN183259
Quantity 100 µg
Price
229.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human SBZF3
Sequence FNMQFLFHSLAMSKPELIICLEARKEPWNVNTEKTAKHSA LSSYLTEDIL
Predicted Reactivity Human :100 %,  
Characteristics This is a rabbit polyclonal antibody against SBZF3. It was validated on Western Blot using a cell lysate as a positive control.
Purification Protein A purified
Alternative Name SBZF3
Background SBZF3, located on chromosome 1, encodes a zinc finger protein.
Molecular Weight 54 kDa
Gene ID 57116
UniProt Q9HD74
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 461 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Zinc Finger Protein 695 (ZNF695) (N-Term) antibody WB Suggested Anti-SBZF3 Antibody Titration: 1.25ug/ml
ELISA Titer: 1:1562500
Positive Control: HepG2 cell lysate
Background publications Strausberg, Feingold, Grouse et al.: "Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences." in: Proceedings of the National Academy of Sciences of the United States of America, Vol. 99, Issue 26, pp. 16899-903, 2002 (PubMed).

Hosts (8), (2)
Reactivities (10)
Applications (10), (3), (2)
Epitopes (2), (2), (2), (1), (1), (1)
back to top