Add to Basket Bulk discount
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

Zinc Finger Protein 529 (ZNF529) antibody

Antigen

Zinc Finger Protein 529 (ZNF529)

Synonyms KIAA1615, ZNF529
Clonality Polyclonal
Host
Alternatives

Rabbit

Reactivity
Alternatives

Human, Mouse (Murine)

Application
Alternatives Western Blotting (WB)
1 reference available
Catalog no. ABIN183262
Quantity 50 µg  (Variants)
Price 317.90 $   Plus shipping costs $45.00
Bulk discount
Shipping to
Availability Will be delivered in 2 to 3 Business Days

Additional Information

Alternative name ZNF529
Gene ID ZNF529
UniProt Q9H731
Immunogen The immunogen for anti-ZNF529 antibody: synthetic peptide directed towards the N terminal of human ZNF529
Sequence QMKIISENVPSYKTHESLTLPRRTHDSEKPYEYKEYEKVF SCDLEFDEYQ
Cross-Reactivity Human, Mouse (Murine)
Format Lyophilized
Reconstitution Add 50 µl of distilled water. Final anti-ZNF529 antibody concentration is 1 mg/ml.
Description The function of the Anti-ZNF529 gene has not yet been determined
Characteristics Antigen Size: 458 amino acids
Molecular Weight 54kDa

Application Details

Application Notes WB Suggested Anti-ZNF529 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Jurkat cell lysate.
Purification Affinity Purified
Buffer PBS
Storage (Long Term) For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Storage (Short Term) Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.
Research Area Chromatin and Nuclear Signaling, Transcription Factors
Restrictions For Research Use only

Publications

Product Strausberg, Feingold, Grouse et al.: "Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences." in: Proceedings of the National Academy of Sciences of the United States of America, Vol. 99, Issue 26, pp. 16899-903, 2002 (PubMed).

Alternatives

Alternatives for antigen "Zinc Finger Protein 529 (ZNF529)", type "Antibodies"
Hosts Rabbit (8)
Reactivities Human (8), Cow (Bovine) (1), Mouse (Murine) (1), Rat (Rattus) (1)
Applications Western Blotting (WB) (8), ELISA (1)
Epitopes N-Term (2), Internal Region (1)