Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN183268

Zinc Finger and SCAN Domain Containing 5A (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms ZNF495, ZSCAN5, ZSCAN5B, ZSCAN5A
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN183268
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-ZSCAN5 antibody: synthetic peptide directed towards the middle region of human ZSCAN5
Sequence KPDASSISQEEPQGEATPVGNRESPGQAGMNSIHSPGPAS PVSHPDGQEA
Predicted Reactivity Human :100%,  
Characteristics This is a rabbit polyclonal antibody against ZSCAN5. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name ZSCAN5
Background ZSCAN5 contains 1 SCAN box domain and may be involved in transcriptional regulation
Molecular Weight 56kDa
Gene ID 79149
NCBI Accession NP_077279, NM_024303
UniProt Q9BUG6
Research Area Chromatin and Nuclear Signaling, Transcription Factors
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-ZSCAN5 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Product cited in: Suzuki, Yoshitomo-Nakagawa, Maruyama et al.: "Construction and characterization of a full length-enriched and a 5'-end-enriched cDNA library." in: Gene, Vol. 200, Issue 1-2, pp. 149-56, 1997 (PubMed).

Alternatives for antigen "Zinc Finger and SCAN Domain Containing 5A", type "Antibodies"
Hosts (5), (1)
Reactivities (6)
Applications (6), (1), (1)
Epitopes (2), (1), (1), (1)
Beacon