Zinc Finger Protein 419 (ZNF419) antibody

Antigen: Zinc Finger Protein 419 (ZNF419)

Synonyms: ZNF419A, FLJ23233, ZNF419, ZNF773, MGC157220

Clonality: Polyclonal

Host: Rabbit

Reactivity: Human

Application: Western Blotting (WB)

Catalog no.: ABIN183271

Additional Information

Alternative name: ZNF419

Gene ID: ZNF419

UniProt: Q96HQ0

Immunogen: The immunogen for anti-ZNF419 antibody: synthetic peptide directed towards the N terminal of human ZNF419

Sequence: MAAAALRDPAQVPVAADLLTDHEEGYVTFEDVAVYFSQEE WRLLDDAQRL

Cross-Reactivity: Human

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-ZNF419 antibody concentration is 1 mg/ml.

Description: The function of Anti-ZNF419 has not yet been determined.

Characteristics: Antigen Size: 510 amino acids

Molecular Weight: 59kDa

Application Details

Application Notes: WB Suggested Anti-ZNF419 Antibody Titration: 0.125ug/ml
ELISA Titer: 1:1562500
Positive Control: Jurkat cell lysate.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Restrictions: For Research Use only

Images

WB Suggested Anti-ZNF419 Antibody Titration: 0.125ug/ml
ELISA Titer: 1:1562500
Positive Control: Jurkat cell lysate

Publications

Product: Strausberg, Feingold, Grouse et al.: "Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences." in: Proceedings of the National Academy of Sciences of the United States of America, Vol. 99, Issue 26, pp. 16899-903, 2002 (PubMed).