Add to Basket Bulk discount
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

Zinc Finger Protein 419 (ZNF419) antibody

Antigen

Zinc Finger Protein 419 (ZNF419)

Synonyms ZNF419A, FLJ23233, ZNF419, ZNF773, MGC157220
Clonality Polyclonal
Host
Alternatives

Rabbit

Reactivity
Alternatives

Human

Application
Alternatives Western Blotting (WB)
1 reference available
Catalog no. ABIN183271
Quantity 50 µg  (Variants)
Price 317.90 $   Plus shipping costs $45.00
Bulk discount
Shipping to
Availability Will be delivered in 2 to 3 Business Days

Additional Information

Alternative name ZNF419
Gene ID ZNF419
UniProt Q96HQ0
Immunogen The immunogen for anti-ZNF419 antibody: synthetic peptide directed towards the N terminal of human ZNF419
Sequence MAAAALRDPAQVPVAADLLTDHEEGYVTFEDVAVYFSQEE WRLLDDAQRL
Cross-Reactivity Human
Format Lyophilized
Reconstitution Add 50 µl of distilled water. Final anti-ZNF419 antibody concentration is 1 mg/ml.
Description The function of Anti-ZNF419 has not yet been determined.
Characteristics Antigen Size: 510 amino acids
Molecular Weight 59kDa

Application Details

Application Notes WB Suggested Anti-ZNF419 Antibody Titration: 0.125ug/ml
ELISA Titer: 1:1562500
Positive Control: Jurkat cell lysate.
Purification Affinity Purified
Buffer PBS
Storage (Long Term) For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Storage (Short Term) Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.
Restrictions For Research Use only

Publications

Product Strausberg, Feingold, Grouse et al.: "Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences." in: Proceedings of the National Academy of Sciences of the United States of America, Vol. 99, Issue 26, pp. 16899-903, 2002 (PubMed).

Alternatives

Alternatives for antigen "Zinc Finger Protein 419 (ZNF419)", type "Antibodies"
Hosts Rabbit (8)
Reactivities Human (8), Cow (Bovine) (2), Mouse (Murine) (1), Rat (Rattus) (1)
Applications Western Blotting (WB) (8), ELISA (1)
Epitopes N-Term (3), C-Term (1)