Did you know that you can buy products from over 140 different suppliers from us?

Retina and Anterior Neural Fold Homeobox 2 (RAX2) (N-Term) antibody

Details for Product No. ABIN183282
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms qrx, rx-l, armd6, raxl1, cord11, ARMD6, CORD11, QRX, RAXL1
Epitope
N-Term
(2), (1), (1)
Reactivity
Cow (Bovine), Dog (Canine), Human
(5)
Host
Rabbit
(3), (2)
Clonality
Polyclonal
Application
Western Blotting (WB)
(5), (2)
Pubmed 1 reference available
Quantity 100 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN183282
229.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human RAXL1
Sequence MFLSPGEGPATEGGGLGPGEEAPKKKHRRNRTTFTTYQLH QLERAFEASH
Predicted Reactivity Lowland gorilla :100 %,   Pygmy chimpanzee :100 %,   Chimpanzee :100 %,   Human :100 %,   Black-handed spider monkey :90 %,   Pig-tailed macaque :90 %,   Bovine :90 %,   Dog :80 %,  
Characteristics This is a rabbit polyclonal antibody against RAXL1. It was validated on Western Blot using a cell lysate as a positive control.
Purification Protein A purified
Alternative Name RAXL1
Background RAXL1 is a hypothetical protein
Molecular Weight 20 kDa
Gene ID 84839
NCBI Accession NM_032753, NP_116142
UniProt Q96IS3
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 184 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Retina and Anterior Neural Fold Homeobox 2 (RAX2) (N-Term) antibody WB Suggested Anti-RAXL1 Antibody Titration: 1.25ug/ml
ELISA Titer: 1:312500
Positive Control: Jurkat cell lysate
Background publications Strausberg, Feingold, Grouse et al.: "Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences." in: Proceedings of the National Academy of Sciences of the United States of America, Vol. 99, Issue 26, pp. 16899-903, 2002 (PubMed).

Validation Images
back to top