Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN183282

Retina and Anterior Neural Fold Homeobox 2 (RAX2) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms ARMD6, CORD11, QRX, RAXL1, qrx, rx-l, armd6, raxl1, cord11
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Cow (Bovine), Dog (Canine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN183282
Quantity 100 µg
Price
229.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-RAXL1 antibody: synthetic peptide directed towards the N terminal of human RAXL1
Sequence MFLSPGEGPATEGGGLGPGEEAPKKKHRRNRTTFTTYQLH QLERAFEASH
Predicted Reactivity Lowland gorilla :100%,   Pygmy chimpanzee :100%,   Chimpanzee :100%,   Human :100%,   Black-handed spider monkey :92%,   Pig-tailed macaque :92%,   Bovine :92%,   Dog :84%,  
Characteristics This is a rabbit polyclonal antibody against RAXL1. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Protein A purified
Alternative Name RAXL1
Background RAXL1 is a hypothetical protein
Molecular Weight 20kDa
Gene ID 84839
NCBI Accession NP_116142, NM_032753
UniProt Q96IS3
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-RAXL1 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Strausberg, Feingold, Grouse et al.: "Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences." in: Proceedings of the National Academy of Sciences of the United States of America, Vol. 99, Issue 26, pp. 16899-903, 2002 (PubMed).

Alternatives for antigen "Retina and Anterior Neural Fold Homeobox 2 (RAX2)", type "Antibodies"
Hosts (3), (2)
Reactivities (5)
Applications (5), (2)
Epitopes (2), (1)
Beacon