Retina and Anterior Neural Fold Homeobox 2 (RAX2) antibody

Antigen: Retina and Anterior Neural Fold Homeobox 2 (RAX2)

Synonyms: QRX, ARMD6, RAXL1, CORD11, MGC15631, RAX2, qrx, rx-l, armd6, raxl1, cord11

Clonality: Polyclonal

Host: Rabbit

Reactivity: Cow (Bovine), Human, Dog (Canine)

Application: Western Blotting (WB)

Catalog no.: ABIN183282

Additional Information

Alternative name: RAX2 / QRX

Gene ID: RAXL1

UniProt: Q96IS3

Immunogen: The immunogen for anti-RAXL1 antibody: synthetic peptide directed towards the N terminal of human RAXL1

Sequence: MFLSPGEGPATEGGGLGPGEEAPKKKHRRNRTTFTTYQLH QLERAFEASH

Cross-Reactivity: Cow (Bovine), Dog (Canine), Human

Format: Lyophilized

Reconstitution: Add 100 µl of distilled water. Final anti-RAXL1 antibody concentration is 1 mg/ml.

Description: RAXL1 is a hypothetical protein

Characteristics: Antigen Size: 184 amino acids

Molecular Weight: 20kDa

Application Details

Application Notes: WB Suggested Anti-RAXL1 Antibody Titration: 1.25ug/ml
ELISA Titer: 1:312500
Positive Control: Jurkat cell lysate.

Purification: Protein A purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Restrictions: For Research Use only

Images

WB Suggested Anti-RAXL1 Antibody Titration: 1.25ug/ml
ELISA Titer: 1:312500
Positive Control: Jurkat cell lysate

Publications

Product: Strausberg, Feingold, Grouse et al.: "Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences." in: Proceedings of the National Academy of Sciences of the United States of America, Vol. 99, Issue 26, pp. 16899-903, 2002 (PubMed).