Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN183283

Cyclin B3 (CCNB3) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms RGD1564367, CYCB3, CG5814, Cyc B3, Dmel\\CG5814, anon-WO0118547.414, cycB3, l(3)L6540, ccnb3-a, zgc:153369, MGC154490, NV16541, CCNB3
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN183283
Quantity 100 µg
Price
229.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-CCNB3 antibody: synthetic peptide directed towards the N terminal of human CCNB3
Sequence MLLPLPPQSSKPVPKKSQSSKIVPSHHDPSEKTGENCQTK ISPSSLQESP
Predicted Reactivity Human : 100%
Characteristics This is a rabbit polyclonal antibody against CCNB3. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Protein A purified
Alternative Name CCNB3
Background CCNB3 belongs to the highly conserved cyclin family, whose members are characterized by a dramatic periodicity in protein abundance through the cell cycle. Cyclins function as regulators of CDK kinases. Different cyclins exhibit distinct expression and degradation patterns which contribute to the temporal coordination of each mitotic event.This cyclin may associate with CDC2 and CDK2 kinases, and be required for proper spindle reorganization and restoration of the interphase nucleus.The protein encoded by this gene belongs to the highly conserved cyclin family, whose members are characterized by a dramatic periodicity in protein abundance through the cell cycle. Cyclins function as regulators of CDK kinases. Different cyclins exhibit distinct expression and degradation patterns which contribute to the temporal coordination of each mitotic event. Studies of similar genes in chick and Drosophila suggest that this cyclin may associate with CDC2 and CDK2 kinases, and be required for proper spindle reorganization and restoration of the interphase nucleus. Two transcript variants encoding different isoforms have been found for this gene.
Molecular Weight 33kDa
Gene ID 85417
NCBI Accession NP_391990, NM_033670
UniProt Q5HYQ1
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-CCNB3 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Nguyen, Manova, Capodieci et al.: "Characterization and expression of mammalian cyclin b3, a prepachytene meiotic cyclin." in: The Journal of biological chemistry, Vol. 277, Issue 44, pp. 41960-9, 2002 (PubMed).

Alternatives for antigen "Cyclin B3 (CCNB3)", type "Antibodies"
Hosts (39), (2)
Reactivities (27), (19), (17), (11), (11), (11)
Applications (16), (15), (9), (5), (3), (2), (1)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (5), (3), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (1)
Beacon