TGFB-Induced Factor Homeobox 2-Like, Y-Linked (TGIF2LY) antibody

Antigen: TGFB-Induced Factor Homeobox 2-Like, Y-Linked (TGIF2LY)

Synonyms: TGIFLY

Clonality: Polyclonal

Host: Rabbit

Reactivity: Human

Application: Western Blotting (WB)

Catalog no.: ABIN183296

Additional Information

Alternative name: TGIF2LY

Gene ID: TGIF2LY

UniProt: Q8IUE0

Immunogen: The immunogen for anti-TGIF2LY antibody: synthetic peptide directed towards the middle region of human TGIF2LY

Sequence: NWFINARRRILPDMLQQRRNDPIIGHKTGKDAHATHLQST EASVPAKSGP

Cross-Reactivity: Human

Format: Lyophilized

Reconstitution: Add 100 µl of distilled water. Final anti-TGIF2LY antibody concentration is 1 mg/ml.

Description: TGIF2LY is a member of the TALE/TGIF homeobox family of transcription factors. This gene lies within the male specific region of chromosome Y, in a block of sequence that is thought to be the result of a large X-to-Y transposition. The C-terminus of this protein is divergent from that of its chromosome X homolog (TGIF2LX), suggesting that this protein may act as a regulator of TGIF2LX.This gene encodes a member of the TALE/TGIF homeobox family of transcription factors. This gene lies within the male specific region of chromosome Y, in a block of sequence that is thought to be the result of a large X-to-Y transposition. The C-terminus of this protein is divergent from that of its chromosome X homolog (TGIF2LX), suggesting that this protein may act as a regulator of TGIF2LX.

Characteristics: Antigen Size: 185 amino acids

Molecular Weight: 21kDa

Application Details

Purification: Protein A purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Research Area: Chromatin and Nuclear Signaling, Transcription Factors

Restrictions: For Research Use only

Images

anti-TGFB-Induced Factor Homeobox 2-Like, Y-Linked (TGIF2LY) antibody

Publications

Product: Skaletsky, Kuroda-Kawaguchi, Minx et al.: "The male-specific region of the human Y chromosome is a mosaic of discrete sequence classes." in: Nature, Vol. 423, Issue 6942, pp. 825-37, 2003 (PubMed).