Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN183304

Zinc Finger and SCAN Domain Containing 29 (ZSCAN29) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms ZNF690, Zfp690, ZSCAN29
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Rabbit, Mouse (Murine), Rat (Rattus), Cow (Bovine), Dog (Canine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN183304
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-ZNF690 antibody: synthetic peptide directed towards the middle region of human ZNF690
Sequence APVLFQSPRGFEAGFENEDNSKRDISEEVQLHRTLLARSE RKIPRYLHQG
Predicted Reactivity Olive baboon :100%,   Human :100%,   Mouse :92%,   Rabbit :90%,   Bovine :90%,   Geobacter sp. M18 :84%,   Dog :81%,   Rat :76%,  
Characteristics This is a rabbit polyclonal antibody against ZNF690. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name ZNF690
Background ZNF690 is a new candidate transcription factor.
Molecular Weight 97kDa
Gene ID 146050
NCBI Accession NP_689668, NM_152455
UniProt Q8IWY8
Research Area Chromatin and Nuclear Signaling, Transcription Factors
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-ZNF690 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Dgany, Avidan, Delaunay et al.: "Congenital dyserythropoietic anemia type I is caused by mutations in codanin-1." in: American journal of human genetics, Vol. 71, Issue 6, pp. 1467-74, 2002 (PubMed).

Alternatives for antigen "Zinc Finger and SCAN Domain Containing 29 (ZSCAN29)", type "Antibodies"
Hosts (4), (3)
Reactivities (7)
Applications (7), (3), (2)
Epitopes (2), (1), (1), (1)
Beacon