Zinc Finger and SCAN Domain Containing 29 (ZSCAN29) (Middle Region) antibody

Details for Product No. ABIN183304
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms ZNF690, Zfp690, ZSCAN29
Epitope
Middle Region
(2), (1), (1), (1)
Reactivity
Rabbit, Mouse (Murine), Rat (Rattus), Cow (Bovine), Dog (Canine), Human
(7)
Host
Rabbit
(4), (3)
Clonality
Polyclonal
Application
Western Blotting (WB)
(7), (3), (2)
Pubmed 1 reference available
Catalog no. ABIN183304
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human ZNF690
Sequence APVLFQSPRGFEAGFENEDNSKRDISEEVQLHRTLLARSE RKIPRYLHQG
Predicted Reactivity Olive baboon :100 %,   Human :100 %,   Mouse :90 %,   Rabbit :90 %,   Bovine :90 %,   Geobacter sp. M18 :80 %,   Dog :80 %,   Rat :70 %,  
Characteristics This is a rabbit polyclonal antibody against ZNF690. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name ZNF690
Background ZNF690 is a new candidate transcription factor.
Molecular Weight 97 kDa
Gene ID 146050
NCBI Accession NM_152455, NP_689668
UniProt Q8IWY8
Research Area Chromatin and Nuclear Signaling, Transcription Factors
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 851 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Zinc Finger and SCAN Domain Containing 29 (ZSCAN29) (Middle Region) antibody WB Suggested Anti-ZNF690 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: HepG2 cell lysate
Background publications Dgany, Avidan, Delaunay et al.: "Congenital dyserythropoietic anemia type I is caused by mutations in codanin-1." in: American journal of human genetics, Vol. 71, Issue 6, pp. 1467-74, 2002 (PubMed).

Hosts (4), (3)
Reactivities (7)
Applications (7), (3), (2)
Epitopes (2), (1), (1), (1)
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
back to top