Did you know that you can buy products from over 140 different suppliers from us?

Zinc Finger Protein 785 (ZNF785) (C-Term) antibody

Details for Product No. ABIN183306
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms ZNF785
Epitope
C-Term
(10), (7), (2), (1), (1)
Reactivity
Human
(22)
Host
Rabbit
(22)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1)
Application
Immunohistochemistry (IHC), Western Blotting (WB)
(22), (13), (2)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN183306
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the C terminal of human ZNF785
Sequence RKTALEAHRWIHRSCSERRAWQQAVVGRSEPIPVLGGKDP PVHFRHFPDI
Predicted Reactivity Human : 100 %
Characteristics This is a rabbit polyclonal antibody against ZNF785. It was validated on Western Blot and immunohistochemistry.
Purification Affinity Purified
Alternative Name ZNF785
Background The function of ZNF785 remains unknown.
Molecular Weight 46 kDa
Gene ID 146540
NCBI Accession NM_152458, NP_689671
UniProt Q8WV14-2
Research Area Chromatin and Nuclear Signaling, Transcription Factors
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 405 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Zinc Finger Protein 785 (ZNF785) (C-Term) antibody anti-Zinc Finger Protein 785 (ZNF785) (C-Term) antibody
anti-Zinc Finger Protein 785 (ZNF785) (C-Term) antibody (2) Human Intestine
anti-Zinc Finger Protein 785 (ZNF785) (C-Term) antibody (3) WB Suggested Anti-ZNF785
Antibody Titration: 0.2-1 µg/mL ELISA Titer: 1:1562500
Positive Control: Transfected 293T
Background publications Loftus, Kim, Sneddon et al.: "Genome duplications and other features in 12 Mb of DNA sequence from human chromosome 16p and 16q." in: Genomics, Vol. 60, Issue 3, pp. 295-308, 1999 (PubMed).

Validation Images
back to top