Zinc Finger Protein 683 (ZNF683) (N-Term) antibody

Details for Product No. ABIN183319
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

 
Antigen
Synonyms ZNF683
Epitope
N-Term
(3), (1)
Reactivity
Human
(7)
Host
Rabbit
(6), (1)
Clonality
Polyclonal
Application
Immunohistochemistry (IHC), Western Blotting (WB)
(7), (3), (1), (1)
Pubmed 1 reference available
Catalog no. ABIN183319
Quantity 100 µg
Price
229.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human ZNF683
Sequence PAPLGTDLQGLQEDALSMKHEPPGLQASSTDDKKFTVKYP QNKDKLGKQP
Predicted Reactivity Human : 100 %
Characteristics This is a rabbit polyclonal antibody against ZNF683. It was validated on Western Blot and immunohistochemistry.
Purification Protein A purified
Alternative Name ZNF683
Background This gene, ZNF683, which is located on chromosome 1, is predicted to encode a zinc finger protein, currently with unknown fucntion.
Molecular Weight 55 kDa
Gene ID 257101
NCBI Accession NM_173574, NP_775845
UniProt Q8IZ20
Research Area Chromatin and Nuclear Signaling, Transcription Factors
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 509 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Zinc Finger Protein 683 (ZNF683) (N-Term) antibody WB Suggested Anti-ZNF683 Antibody Titration: 1.25ug/ml
ELISA Titer: 1:312500
Positive Control: HepG2 cell lysate
anti-Zinc Finger Protein 683 (ZNF683) (N-Term) antibody (2) anti-Zinc Finger Protein 683 (ZNF683) (N-Term) antibody (Image 2)
Background publications Strausberg, Feingold, Grouse et al.: "Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences." in: Proceedings of the National Academy of Sciences of the United States of America, Vol. 99, Issue 26, pp. 16899-903, 2002 (PubMed).

Hosts (6), (1)
Reactivities (7)
Applications (7), (3), (1), (1)
Epitopes (3), (1)
back to top