Zinc Finger Protein 683 (ZNF683) antibody

Antigen: Zinc Finger Protein 683 (ZNF683)

Synonyms: MGC33414, RP11-569G9.6, ZNF683

Clonality: Polyclonal

Host: Rabbit

Reactivity: Human

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Catalog no.: ABIN183319

Additional Information

Alternative name: ZNF683

Gene ID: ZNF683

UniProt: Q8IZ20

Immunogen: The immunogen for anti-ZNF683 antibody: synthetic peptide directed towards the N terminal of human ZNF683

Sequence: PAPLGTDLQGLQEDALSMKHEPPGLQASSTDDKKFTVKYP QNKDKLGKQP

Cross-Reactivity: Human

Format: Lyophilized

Reconstitution: Add 100 µl of distilled water. Final anti-ZNF683 antibody concentration is 1 mg/ml.

Description: This gene, ZNF683, which is located on chromosome 1, is predicted to encode a zinc finger protein, currently with unknown fucntion.

Characteristics: Antigen Size: 509 amino acids

Molecular Weight: 55kDa

Application Details

Application Notes: WB Suggested Anti-ZNF683 Antibody Titration: 1.25ug/ml
ELISA Titer: 1:312500
Positive Control: HepG2 cell lysate.

Purification: Protein A purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Research Area: Chromatin and Nuclear Signaling, Transcription Factors

Restrictions: For Research Use only

Images

WB Suggested Anti-ZNF683 Antibody Titration: 1.25ug/ml
ELISA Titer: 1:312500
Positive Control: HepG2 cell lysate

anti-Zinc Finger Protein 683 (ZNF683) antibody (Image 2)

Publications

Product: Strausberg, Feingold, Grouse et al.: "Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences." in: Proceedings of the National Academy of Sciences of the United States of America, Vol. 99, Issue 26, pp. 16899-903, 2002 (PubMed).