Zinc Finger Protein 660 (ZNF660) antibody

Antigen: Zinc Finger Protein 660 (ZNF660)

Synonyms: FLJ36870

Clonality: Polyclonal

Host: Rabbit

Reactivity: Dog (Canine), Human, Mouse (Murine), Rat (Rattus)

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Catalog no.: ABIN183320

Additional Information

Alternative name: ZNF660

Gene ID: ZNF660

UniProt: Q6AZW8

Immunogen: The immunogen for anti-ZNF660 antibody: synthetic peptide directed towards the C terminal of human ZNF660

Sequence: TFRQTSQVILHLRTHTKEKPYKCSECGKAYRYSSQLIQHQ RKHNEEKETS

Cross-Reactivity: Dog (Canine), Human, Mouse (Murine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 100 µl of distilled water. Final anti-ZNF660 antibody concentration is 1 mg/ml.

Description: Located on chromosome 3, the ZNF660 gene encodes for zinc finger protein 660.

Characteristics: Antigen Size: 331 amino acids

Molecular Weight: 38kDa

Application Details

Application Notes: WB Suggested Anti-ZNF660 Antibody Titration: 1.25ug/ml
ELISA Titer: 1:312500
Positive Control: HepG2 cell lysate.

Purification: Protein A purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Research Area: Chromatin and Nuclear Signaling, Transcription Factors

Restrictions: For Research Use only

Images

WB Suggested Anti-ZNF660 Antibody Titration: 1.25ug/ml
ELISA Titer: 1:312500
Positive Control: HepG2 cell lysate

anti-Zinc Finger Protein 660 (ZNF660) antibody (Image 2)

Publications

Product: Strausberg, Feingold, Grouse et al.: "Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences." in: Proceedings of the National Academy of Sciences of the United States of America, Vol. 99, Issue 26, pp. 16899-903, 2002 (PubMed).