Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN183326

Zinc Finger Protein 713 (ZNF713) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms ZNF713
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN183326
Quantity 100 µg
Price
229.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-ZNF713 antibody: synthetic peptide directed towards the N terminal of human ZNF713
Sequence ERLAGDSFWYSILGGLWDFDYHPEFNQENHKRYLGQVTLT HKKITQERSL
Predicted Reactivity Pig : 76%
Characteristics This is a rabbit polyclonal antibody against ZNF713. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Protein A purified
Alternative Name ZNF713
Background ZNF713 is a new candidate transcription factor.
Molecular Weight 50kDa
Gene ID 349075
NCBI Accession NP_872439, NM_182633
UniProt Q8N859
Research Area Chromatin and Nuclear Signaling, Transcription Factors
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-ZNF713 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Strausberg, Feingold, Grouse et al.: "Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences." in: Proceedings of the National Academy of Sciences of the United States of America, Vol. 99, Issue 26, pp. 16899-903, 2002 (PubMed).

Alternatives for antigen "Zinc Finger Protein 713 (ZNF713)", type "Antibodies"
Hosts (8), (1)
Reactivities (9), (1), (1), (1), (1), (1)
Applications (9), (1)
Epitopes (3), (2), (2), (1), (1), (1), (1)
Beacon