Zinc Finger Protein 713 (ZNF713) (N-Term) antibody

Details for Product No. ABIN183326
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms ZNF713
Epitope
N-Term
(3), (1), (1), (1), (1)
Reactivity
Human
(7), (1), (1), (1), (1), (1)
Host
Rabbit
(6), (1)
Clonality
Polyclonal
Application
Western Blotting (WB)
(7), (1)
Pubmed 1 reference available
Catalog no. ABIN183326
Quantity 100 µg
Price
229.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human ZNF713
Sequence ERLAGDSFWYSILGGLWDFDYHPEFNQENHKRYLGQVTLT HKKITQERSL
Predicted Reactivity Pig : 76 %
Characteristics This is a rabbit polyclonal antibody against ZNF713. It was validated on Western Blot using a cell lysate as a positive control.
Purification Protein A purified
Alternative Name ZNF713
Background ZNF713 is a new candidate transcription factor.
Molecular Weight 50 kDa
Gene ID 349075
NCBI Accession NM_182633, NP_872439
UniProt Q8N859
Research Area Chromatin and Nuclear Signaling, Transcription Factors
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 430 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Background publications Strausberg, Feingold, Grouse et al.: "Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences." in: Proceedings of the National Academy of Sciences of the United States of America, Vol. 99, Issue 26, pp. 16899-903, 2002 (PubMed).

Hosts (6), (1)
Reactivities (7), (1), (1), (1), (1), (1)
Applications (7), (1)
Epitopes (3), (1), (1), (1), (1)
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
back to top