Zinc Finger Protein 713 (ZNF713) antibody

Antigen: Zinc Finger Protein 713 (ZNF713)

Synonyms: FLJ39963, ZNF713, MGC151932

Clonality: Polyclonal

Host: Rabbit

Reactivity: Human

Application: Western Blotting (WB)

Catalog no.: ABIN183326

Additional Information

Alternative name: ZNF713

Gene ID: ZNF713

UniProt: Q8N859

Immunogen: The immunogen for anti-ZNF713 antibody: synthetic peptide directed towards the N terminal of human ZNF713

Sequence: ERLAGDSFWYSILGGLWDFDYHPEFNQENHKRYLGQVTLT HKKITQERSL

Cross-Reactivity: Human

Format: Lyophilized

Reconstitution: Add 100 µl of distilled water. Final anti-ZNF713 antibody concentration is 1 mg/ml.

Description: ZNF713 is a new candidate transcription factor.

Characteristics: Antigen Size: 430 amino acids

Molecular Weight: 50kDa

Application Details

Application Notes: WB Suggested Anti-ZNF713 Antibody Titration: 1.25ug/ml
ELISA Titer: 1:1562500
Positive Control: Human Spleen.

Purification: Protein A purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Research Area: Chromatin and Nuclear Signaling, Transcription Factors

Restrictions: For Research Use only

Images

WB Suggested Anti-ZNF713 Antibody Titration: 1.25ug/ml
ELISA Titer: 1:1562500
Positive Control: Human Spleen

Publications

Product: Strausberg, Feingold, Grouse et al.: "Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences." in: Proceedings of the National Academy of Sciences of the United States of America, Vol. 99, Issue 26, pp. 16899-903, 2002 (PubMed).