DEAD (Asp-Glu-Ala-Asp) Box Polypeptide 5 (DDX5) antibody

Antigen: DEAD (Asp-Glu-Ala-Asp) Box Polypeptide 5 (DDX5)

Synonyms: p68, HLR1, G17P1, HUMP68, DKFZp434E109, DKFZp686J01190, Hlr1, MGC118083, 2600009A06Rik, wu:fa56a07, wu:fb11e01, wu:fb16c10, wu:fb53b05, ddx5, MGC76265, DDX5, DKFZp459M043

Clonality: Polyclonal

Host: Rabbit

Reactivity: Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Chicken

Conjugate: Un-conjugated

Application: Western Blotting (WB)

Catalog no.: ABIN183331

Additional Information

Alternative name: DEAD box protein 5

Gene ID: DDX5

UniProt: P17844

Immunogen: The immunogen for anti-DDX5 antibody: synthetic peptide directed towards the C terminal of human DDX5

Sequence: SFGSNFVSAGIQTSFRTGNPTGTYQNGYDSTQQYGSNVPN MHNGMNQQAY

Cross-Reactivity: Cow (Bovine), Dog (Canine), Chicken, Human, Mouse (Murine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 100 µl of distilled water. Final anti-DDX5 antibody concentration is 1 mg/ml.

Description: DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure, such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. DDX5 encodes a DEAD box protein, which is a RNA-dependent ATPase, and also a proliferation-associated nuclear antigen, specifically reacting with the simian virus 40 tumor antigen. DDX5 consists of 13 exons, and alternatively spliced transcripts containing several intron sequences have been detected, but no isoforms encoded by these transcripts have been identified.

Characteristics: Antigen Size: 614 amino acids

Molecular Weight: 68kDa

Application Details

Application Notes: WB Suggested Anti-DDX5 Antibody Titration: 1.25ug/ml
ELISA Titer: 1:1562500
Positive Control: Jurkat cell lysate.

Purification: Protein A purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Restrictions: For Research Use only

Images

WB Suggested Anti-DDX5 Antibody Titration: 1.25ug/ml
ELISA Titer: 1:1562500
Positive Control: Jurkat cell lysate

Sample Type: 2. mouse brain extracts (80ug)
3. rat brain extract (80ug)
Primary Antibody Dilution: 2ug/ml
Secondary Antibody: IRDye 800CW goat anti-rabbit from Li-COR Bioscience
Secondary Antibody Dilution: 1: 20,000
Image Submitted by: Yuzhi Chen
University of Arkansas for Medical Science

Publications

Product: Guil, Gattoni, Carrascal et al.: "Roles of hnRNP A1, SR proteins, and p68 helicase in c-H-ras alternative splicing regulation." in: Molecular and cellular biology, Vol. 23, Issue 8, pp. 2927-41, 2003 (PubMed).