Add to Basket Bulk discount
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

DEAD (Asp-Glu-Ala-Asp) Box Polypeptide 5 (DDX5) antibody

Antigen

DEAD (Asp-Glu-Ala-Asp) Box Polypeptide 5 (DDX5)

Synonyms p68, HLR1, G17P1, HUMP68, DKFZp434E109, DKFZp686J01190, Hlr1, MGC118083, 2600009A06Rik, wu:fa56a07, wu:fb11e01, wu:fb16c10, wu:fb53b05, ddx5, MGC76265, DDX5, DKFZp459M043
Clonality Polyclonal
Host
Alternatives

Rabbit

Reactivity
Alternatives

Cow (Bovine), Human, Dog (Canine), Mouse (Murine), Rat (Rattus), Chicken

Conjugate
Alternatives Un-conjugated
Application
Alternatives Western Blotting (WB)
1 reference available
Catalog no. ABIN183332
Quantity 0.1 mg  (Variants)
Price 251.90 $   Plus shipping costs $45.00
Bulk discount
Shipping to
Availability Will be delivered in 2 to 3 Business Days

Additional Information

Alternative name DEAD box protein 5
Gene ID DDX5
UniProt P17844
Immunogen The immunogen for anti-DDX5 antibody: synthetic peptide directed towards the N terminal of human DDX5
Sequence RGRDRGFGAPRFGGSRAGPLSGKKFGNPGEKLVKKKWNLD ELPKFEKNFY
Cross-Reactivity Cow (Bovine), Dog (Canine), Chicken, Human, Mouse (Murine), Rat (Rattus)
Format Lyophilized
Reconstitution Add 100 µl of distilled water. Final anti-DDX5 antibody concentration is 1 mg/ml.
Description DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure, such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. DDX5 encodes a DEAD box protein, which is a RNA-dependent ATPase, and also a proliferation-associated nuclear antigen, specifically reacting with the simian virus 40 tumor antigen. DDX5 consists of 13 exons, and alternatively spliced transcripts containing several intron sequences have been detected, but no isoforms encoded by these transcripts have been identified.
Characteristics Antigen Size: 614 amino acids
Molecular Weight 68kDa

Application Details

Application Notes WB Suggested Anti-DDX5 Antibody Titration: 1.25ug/ml
ELISA Titer: 1:62500
Positive Control: Jurkat cell lysate.
Purification Protein A purified
Buffer PBS
Storage (Long Term) For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Storage (Short Term) Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.
Restrictions For Research Use only

Publications

Product Guil, Gattoni, Carrascal et al.: "Roles of hnRNP A1, SR proteins, and p68 helicase in c-H-ras alternative splicing regulation." in: Molecular and cellular biology, Vol. 23, Issue 8, pp. 2927-41, 2003 (PubMed).

Alternatives

Alternatives for antigen "DEAD (Asp-Glu-Ala-Asp) Box Polypeptide 5 (DDX5)", type "Antibodies"
Hosts Rabbit (62), Goat (8), Mouse (4)
Reactivities Human (71), Mouse (Murine) (50), Rat (Rattus) (50), Cow (Bovine) (38), Horse (Equine) (36), Rabbit (36), Chicken (20), Dog (Canine) (5), Cat (Feline) (1)
Applications Immunofluorescence (IF) (36), Western Blotting (WB) (36), ELISA (27), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) (13), Immunohistochemistry (IHC) (7), Immunocytochemistry (ICC) (6), Immunohistochemistry (Formalin-fixed Sections) (IHC (f)) (6), Immunoprecipitation (IP) (6), Immunoelectron Microscopy (IEM) (2), Dot Blot (Dot) (1), Immunoassay (IA) (1), Immunohistochemistry (Frozen Sections) (IHC (fro)) (1)
Conjugates Alexa Fluor 350 (2), Alexa Fluor 488 (2), Alexa Fluor 555 (2), Alexa Fluor 647 (2), Biotin (2), Cy3 (2), Cy5 (2), Cy5.5 (2), Cy7 (2), FITC (2), Gold (2), HRP (2), PE (2), PE-Cy3 (2), PE-Cy5 (2), PE-Cy5.5 (2), PE-Cy7 (2), Un-conjugated (2)
Epitopes AA 312-345 (18), AA 591-595,Tyr593 (18), C-Term (6), AA 448-614 (1), AA 550-600 (1), Center (1), Internal Region (1), N-Term (1), pTyr593 (1)