Transmembrane Protein 108 (TMEM108) antibody

Antigen: Transmembrane Protein 108 (TMEM108)

Synonyms: MGC3040, R74726, AI462967, KIAA1690, B130017P16Rik, RGD1311530, TMEM108, MGC166037

Clonality: Polyclonal

Host: Rabbit

Reactivity: Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Dog (Canine)

Application: Western Blotting (WB)

Catalog no.: ABIN183351

Additional Information

Alternative name: TMEM108

Gene ID: TMEM108

UniProt: Q6UXF1-2

Immunogen: The immunogen for anti-TMEM108 antibody: synthetic peptide directed towards the middle region of human TMEM108

Sequence: NRLVPAGTWKPGTAGNISHVAEGDKPQHRATICLSKMDIA WVILAISVPI

Cross-Reactivity: Cow (Bovine), Dog (Canine), Human, Mouse (Murine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 100 µl of distilled water. Final anti-TMEM108 antibody concentration is 1 mg/ml.

Description: TMEM108's function has not been determined yet.

Characteristics: Antigen Size: 487 amino acids

Molecular Weight: 54kDa

Application Details

Application Notes: WB Suggested Anti-TMEM108 Antibody Titration: 1.25ug/ml
ELISA Titer: 1:312500
Positive Control: Human brain.

Purification: Protein A purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Restrictions: For Research Use only

Images

WB Suggested Anti-TMEM108 Antibody Titration: 1.25ug/ml
ELISA Titer: 1:312500
Positive Control: Human brain

Publications

Product: Clark, Gurney, Abaya et al.: "The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment." in: Genome research, Vol. 13, Issue 10, pp. 2265-70, 2003 (PubMed).