TMEM108 antibody (Middle Region)

Catalog No. ABIN629878

This Rabbit Polyclonal antibody specifically detects TMEM108 in WB. It exhibits reactivity toward Human, Mouse, Rat and Dog.

Quick Overview for TMEM108 antibody (Middle Region) (ABIN629878)

Target: TMEM108 (Transmembrane Protein 108 (TMEM108))

Reactivity: Human, Mouse, Rat, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This TMEM108 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-TMEM108 Antibody

Binding Specificity: Middle Region

Specificity: TMEM108 antibody was raised against the middle region of TMEM108

Purification: Purified

Immunogen: TMEM108 antibody was raised using the middle region of TMEM108 corresponding to a region with amino acids NRLVPAGTWKPGTAGNISHVAEGDKPQHRATICLSKMDIAWVILAISVPI

Application Details

Application Notes: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

TMEM108 Blocking Peptide, (ABIN5616655), is also available for use as a blocking control in assays to test for specificity of this TMEM108 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMEM108 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for TMEM108

Target: TMEM108 (Transmembrane Protein 108 (TMEM108))

Alternative Name: TMEM108

Background: TMEM108's function has not been determined yet.

Molecular Weight: 54 kDa (MW of target protein)