Annexin A13 (ANXA13) antibody

Antigen: Annexin A13 (ANXA13)

Synonyms: ISA, ANX13, MGC150460, AV055219, 1810034H17Rik, anx13, wu:fb40a08, ANXA13, MGC108373

Clonality: Polyclonal

Host: Rabbit

Reactivity: Human, Rabbit

Application: Western Blotting (WB)

Catalog no.: ABIN183368

Additional Information

Alternative name: Annexin A13 / ANXA13

Gene ID: ANXA13

Immunogen: The immunogen for anti-ANXA13 antibody: synthetic peptide directed towards the N terminal of human ANXA13

Sequence: EPEAPQPAKASSPQGFDVDRDAKKLNKACKGMGTNEAAII EILSGRTSDE

Cross-Reactivity: Human, Rabbit

Format: Lyophilized

Reconstitution: Add 100 µl of distilled water. Final anti-ANXA13 antibody concentration is 1 mg/ml.

Description: ANXA13 encodes a member of the annexin family. Members of this calcium-dependent phospholipid-binding protein family play a role in the regulation of cellular growth and in signal transduction pathways. The specific function of ANXA13 has not yet been determined, however, it is associated with the plasma membrane of undifferentiated, proliferating endothelial cells and differentiated villus enterocytes.

Characteristics: Antigen Size: 357 amino acids

Molecular Weight: 39kDa

Application Details

Application Notes: WB Suggested Anti-ANXA13 Antibody Titration: 1.25ug/ml
ELISA Titer: 1:312500
Positive Control: Human Small Intestine.

Purification: Protein A purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Restrictions: For Research Use only

Images

WB Suggested Anti-ANXA13 Antibody Titration: 1.25ug/ml
ELISA Titer: 1:312500
Positive Control: Human Small Intestine

Publications

Product: Iglesias, Morgan, Jenkins et al.: "Comparative genetics and evolution of annexin A13 as the founder gene of vertebrate annexins." in: Molecular biology and evolution, Vol. 19, Issue 5, pp. 608-18, 2002 (PubMed).