Add to Basket Bulk discount
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

Annexin A13 (ANXA13) antibody

Antigen

Annexin A13 (ANXA13)

Synonyms ISA, ANX13, MGC150460, AV055219, 1810034H17Rik, anx13, wu:fb40a08, ANXA13, MGC108373
Clonality Polyclonal
Host
Alternatives

Rabbit

Reactivity
Alternatives

Human, Rabbit

Application
Alternatives Western Blotting (WB)
1 reference available
Catalog no. ABIN183368
Quantity 0.1 mg  (Variants)
Price 251.90 $   Plus shipping costs $45.00
Bulk discount
Shipping to
Availability Will be delivered in 2 to 3 Business Days

Additional Information

Alternative name Annexin A13 / ANXA13
Gene ID ANXA13
Immunogen The immunogen for anti-ANXA13 antibody: synthetic peptide directed towards the N terminal of human ANXA13
Sequence EPEAPQPAKASSPQGFDVDRDAKKLNKACKGMGTNEAAII EILSGRTSDE
Cross-Reactivity Human, Rabbit
Format Lyophilized
Reconstitution Add 100 µl of distilled water. Final anti-ANXA13 antibody concentration is 1 mg/ml.
Description ANXA13 encodes a member of the annexin family. Members of this calcium-dependent phospholipid-binding protein family play a role in the regulation of cellular growth and in signal transduction pathways. The specific function of ANXA13 has not yet been determined, however, it is associated with the plasma membrane of undifferentiated, proliferating endothelial cells and differentiated villus enterocytes.
Characteristics Antigen Size: 357 amino acids
Molecular Weight 39kDa

Application Details

Application Notes WB Suggested Anti-ANXA13 Antibody Titration: 1.25ug/ml
ELISA Titer: 1:312500
Positive Control: Human Small Intestine.
Purification Protein A purified
Buffer PBS
Storage (Long Term) For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Storage (Short Term) Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.
Restrictions For Research Use only

Publications

Product Iglesias, Morgan, Jenkins et al.: "Comparative genetics and evolution of annexin A13 as the founder gene of vertebrate annexins." in: Molecular biology and evolution, Vol. 19, Issue 5, pp. 608-18, 2002 (PubMed).

Alternatives

Alternatives for antigen "Annexin A13 (ANXA13)", type "Antibodies"
Hosts Rabbit (8), Goat (3)
Reactivities Human (6), Mouse (Murine) (3), Cow (Bovine) (1), Dog (Canine) (1), Rabbit (1), Rat (Rattus) (1)
Applications Western Blotting (WB) (9), ELISA (2)
Epitopes N-Term (3), AA 1-316 (1), Center (1), Internal Region (1)