Add to Basket Bulk discount
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

Methylthioribose-1-Phosphate Isomerase Homolog (S. Cerevisiae) (Mri1) antibody

Antigen

Methylthioribose-1-Phosphate Isomerase Homolog (S. Cerevisiae) (Mri1)

Synonyms 2410018C20Rik, CH73-131E21.1, MTNA, MGC3207, Ypr118w, MGC105780, RGD1307789, MGC134253, IDI2, M1Pi, ZmIDI2, MGC116493
Clonality Polyclonal
Host
Alternatives

Rabbit

Reactivity
Alternatives

Cow (Bovine), Mouse (Murine), Rat (Rattus), Dog (Canine), Xenopus laevis, Human, Zebrafish

Application
Alternatives Western Blotting (WB)
1 reference available
Catalog no. ABIN183484
Quantity 0.1 mg  (Variants)
Price 251.90 $   Plus shipping costs $45.00
Bulk discount
Shipping to
Availability Will be delivered in 2 to 3 Business Days

Additional Information

Alternative name MRI1
Gene ID Mri1
UniProt Q9CQT1
Immunogen The immunogen for anti-Mri1 antibody: synthetic peptide corresponding to a region of Mouse
Sequence IVAKHHGVPFYVAAPSSSCDLHLESGKEIVIEERPSQELT DLNGVRIAAQ
Cross-Reactivity Cow (Bovine), Dog (Canine), Human, Mouse (Murine), Rat (Rattus)
Format Lyophilized
Reconstitution Add 100 µl of distilled water. Final anti-Mri1 antibody concentration is 1 mg/ml.
Description This protein was disclosed by the RIKEN Mouse Gene Encyclopaedia Project, a systematic approach to determining the full coding potential of the mouse genome, involves collection and sequencing of full length complementary DNAs and physical mapping of the corresponding genes to the mouse genome.
Characteristics Antigen Size: 369 amino acids
Molecular Weight 41kDa

Application Details

Application Notes WB Suggested Anti-Mri1 Antibody Titration: 2.5ug/ml
ELISA Titer: 1:1562500
Positive Control: NIH/3T3 cell lysate.
Purification Protein A purified
Buffer PBS
Storage (Long Term) For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Storage (Short Term) Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.
Restrictions For Research Use only

Publications

Product Katayama, Tomaru, Kasukawa et al.: "Antisense transcription in the mammalian transcriptome." in: Science (New York, N.Y.), Vol. 309, Issue 5740, pp. 1564-6, 2005 (PubMed).

Alternatives

Alternatives for antigen "Methylthioribose-1-Phosphate Isomerase Homolog (S. Cerevisiae) (Mri1)", type "Antibodies"
Hosts Rabbit (8), Mouse (3)
Reactivities Human (9), Mouse (Murine) (4), Cow (Bovine) (2), Dog (Canine) (2), Rat (Rattus) (2), Cat (Feline) (1), Chicken (1)
Applications Western Blotting (WB) (11), Immunohistochemistry (IHC) (4), Immunofluorescence (IF) (3), ELISA (2), Flow Cytometry (FACS) (2), Immunoprecipitation (IP) (1)
Epitopes N-Term (3), Transcript Variant 1 (3)