Cholinergic Receptor, Nicotinic, beta 2 (Neuronal) (CHRNB2) antibody

Antigen: Cholinergic Receptor, Nicotinic, beta 2 (Neuronal) (CHRNB2)

Synonyms: Acrb2, Acrb-2, [b]2-nAchR, C030030P04Rik, EFNL3, nAChRB2

Clonality: Polyclonal

Host: Rabbit

Reactivity: Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Chicken, Pig (Porcine), Xenopus laevis

Conjugate: Un-conjugated

Application: Western Blotting (WB)

Catalog no.: ABIN183541

Additional Information

Alternative name: Neuronal acetylcholine receptor subunit beta-2

Gene ID: CHRNB2

UniProt: P17787

Immunogen: The immunogen for anti-CHRNB2 antibody: synthetic peptide directed towards the middle region of human CHRNB2

Sequence: KIEVKHFPFDQQNCTMKFRSWTYDRTEIDLVLKSEVASLD DFTPSGEWDI

Cross-Reactivity: Cow (Bovine), Chicken, Human, Mouse (Murine), Pig (Porcine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 100 µl of distilled water. Final anti-CHRNB2 antibody concentration is 1 mg/ml.

Description: Mutations in nAChRs are found in a rare form of nocturnal frontal lobe epilepsy . Previously, some nAChR mutations have been described that are associated with additional neurological features such as psychiatric disorders or cognitive defects. A new CHRNB2 mutation located in transmembrane region 3 (M3), outside the known ADNFLE mutation cluster. The CHRNB2 mutation I312M, which occurred de novo in twins, markedly increases the receptor's sensitivity to acetylcholine. Phenotypically, the mutation is associated not only with typical ADNFLE, but also with distinct deficits in memory. The cognitive problems are most obvious in tasks requiring the organization and storage of verbal information.

Characteristics: Antigen Size: 502 amino acids

Molecular Weight: 57kDa

Application Details

Application Notes: WB Suggested Anti-CHRNB2 Antibody Titration: 5.0ug/ml
ELISA Titer: 1:312500
Positive Control: HepG2 cell lysate.

Purification: Protein A purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Restrictions: For Research Use only

Images

WB Suggested Anti-CHRNB2 Antibody Titration: 5.0ug/ml
ELISA Titer: 1:312500
Positive Control: HepG2 cell lysate

Publications

Product: Feng, Niu, Xing et al.: "A common haplotype of the nicotine acetylcholine receptor alpha 4 subunit gene is associated with vulnerability to nicotine addiction in men." in: American journal of human genetics, Vol. 75, Issue 1, pp. 112-21, 2004 (PubMed).