Helicase-Like Transcription Factor (HLTF) antibody

Antigen: Helicase-Like Transcription Factor (HLTF)

Synonyms: Snf2l3, Smarca3, smarca3, wu:fc33f07, HLTF, SMARCA3, MGC131155, RUSH, ZBU1, HLTF1, RNF80, HIP116, SNF2L3, HIP116A, P113, AF010600, BC057116

Clonality: Polyclonal

Host: Rabbit

Reactivity: Dog (Canine), Human, Rat (Rattus), Rabbit

Conjugate: Un-conjugated

Application: Western Blotting (WB)

Catalog no.: ABIN183630

Additional Information

Alternative name: SMARCA3 / HLTF

Gene ID: SMARCA3

UniProt: Q14527

Immunogen: The immunogen for anti-SMARCA3 antibody: synthetic peptide directed towards the C terminal of human SMARCA3

Sequence: FIVKDSVEENMLKIQNKKRELAAGAFGTKKPNADEMKQAK INEIRTLIDL

Cross-Reactivity: Dog (Canine), Human, Rabbit, Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 100 µl of distilled water. Final anti-SMARCA3 antibody concentration is 1 mg/ml.

Description: SMARCA3 (HLTF) is a member of the SWI/SNF family. Members of this family have helicase and ATPase activities and are thought to regulate transcription of certain genes by altering the chromatin structure around those genes. SMARCA3 contains a RING finger DNA binding motif. Western blots using two different antibodies against two unique regions of this protein target confirm the same apparent molecular weight in our tests.The protein encoded by this gene is a member of the SWI/SNF family of proteins. Members of this family have helicase and ATPase activities and are thought to regulate transcription of certain genes by altering the chromatin structure around those genes. The encoded protein contains a RING finger DNA binding motif. Two transcript variants encoding the same protein have been found for this gene. However, use of an alternative translation start site produces an isoform which is truncated at the N-terminus as compared to the full-length protein.

Characteristics: Antigen Size: 1009 amino acids

Molecular Weight: 114kDa

Application Details

Application Notes: WB Suggested Anti-SMARCA3 Antibody Titration: 5.0ug/ml
ELISA Titer: 1:62500
Positive Control: Transfected 293T.

Purification: Protein A purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Restrictions: For Research Use only

Images

WB Suggested Anti-SMARCA3 Antibody Titration: 5.0ug/ml
ELISA Titer: 1:62500
Positive Control: Transfected 293T

Publications

Beausoleil, Jedrychowski, Schwartz et al.: "Large-scale characterization of HeLa cell nuclear phosphoproteins." in: Proceedings of the National Academy of Sciences of the United States of America, Vol. 101, Issue 33, pp. 12130-5, 2004 (PubMed).