Add to Basket Bulk discount
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

Zinc Finger Protein 282 (ZNF282) antibody

Antigen

Zinc Finger Protein 282 (ZNF282)

Synonyms HUB1
Clonality Polyclonal
Host
Alternatives

Rabbit

Reactivity
Alternatives

Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Dog (Canine)

Application
Alternatives Western Blotting (WB)
1 reference available
Catalog no. ABIN183642
Quantity 0.1 mg  (Variants)
Price 251.90 $   Plus shipping costs $45.00
Bulk discount
Shipping to
Availability Will be delivered in 2 to 3 Business Days

Additional Information

Alternative name ZNF282
Gene ID ZNF282
UniProt Q9UDV7
Immunogen The immunogen for anti-ZNF282 antibody: synthetic peptide directed towards the N terminal of human ZNF282
Sequence QQLGIQGLGLDSGSWSWAQALPPEEVCHQEPALRGEMAEG MPPMQAQEWD
Cross-Reactivity Cow (Bovine), Dog (Canine), Human, Mouse (Murine), Rat (Rattus)
Format Lyophilized
Reconstitution Add 100 µl of distilled water. Final anti-ZNF282 antibody concentration is 1 mg/ml.
Description ZNF282 contains 1 KRAB domain and 5 C2H2-type zinc fingers. It belongs to the krueppel C2H2-type zinc-finger protein family and binds to the U5 repressive element (U5RE) of the human T cell leukemia virus type I long terminal repeat.
Characteristics Antigen Size: 671 amino acids
Molecular Weight 74kDa

Application Details

Application Notes WB Suggested Anti-ZNF282 Antibody Titration: 1.25ug/ml
ELISA Titer: 1:312500
Positive Control: Transfected 293T.
Purification Protein A purified
Buffer PBS
Storage (Long Term) For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Storage (Short Term) Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.
Research Area Chromatin and Nuclear Signaling, Transcription Factors
Restrictions For Research Use only

Publications

Product Cheng, Kapranov, Drenkow et al.: "Transcriptional maps of 10 human chromosomes at 5-nucleotide resolution." in: Science (New York, N.Y.), Vol. 308, Issue 5725, pp. 1149-54, 2005 (PubMed).

Alternatives

Alternatives for antigen "Zinc Finger Protein 282 (ZNF282)", type "Antibodies"
Hosts Rabbit (3)
Reactivities Human (3), Cow (Bovine) (1), Dog (Canine) (1), Mouse (Murine) (1), Rat (Rattus) (1), Zebrafish (1)
Applications Western Blotting (WB) (3)
Epitopes C-Term (1), N-Term (1)