Zinc Finger Protein 282 (ZNF282) antibody

Antigen: Zinc Finger Protein 282 (ZNF282)

Synonyms: HUB1

Clonality: Polyclonal

Host: Rabbit

Reactivity: Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Zebrafish

Application: Western Blotting (WB)

Catalog no.: ABIN183643

Additional Information

Alternative name: ZNF282

Gene ID: ZNF282

UniProt: Q9UDV7

Immunogen: The immunogen for anti-ZNF282 antibody: synthetic peptide directed towards the C terminal of human ZNF282

Sequence: FIRKQNLLKHQRIHTGERPYTCGECGKSFRYKESLKDHLR VHSGGPGPGA

Cross-Reactivity: Cow (Bovine), Dog (Canine), Human, Mouse (Murine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 100 µl of distilled water. Final anti-ZNF282 antibody concentration is 1 mg/ml.

Description: ZNF282 contains 1 KRAB domain and 5 C2H2-type zinc fingers. It belongs to the krueppel C2H2-type zinc-finger protein family and binds to the U5 repressive element (U5RE) of the human T cell leukemia virus type I long terminal repeat.

Characteristics: Antigen Size: 671 amino acids

Molecular Weight: 74kDa

Application Details

Application Notes: WB Suggested Anti-ZNF282 Antibody Titration: 1.25ug/ml
ELISA Titer: 1:312500
Positive Control: Transfected 293T.

Purification: Protein A purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Research Area: Chromatin and Nuclear Signaling, Transcription Factors

Restrictions: For Research Use only

Images

WB Suggested Anti-ZNF282 Antibody Titration: 1.25ug/ml
ELISA Titer: 1:312500
Positive Control: Transfected 293T

Publications

Product: Cheng, Kapranov, Drenkow et al.: "Transcriptional maps of 10 human chromosomes at 5-nucleotide resolution." in: Science (New York, N.Y.), Vol. 308, Issue 5725, pp. 1149-54, 2005 (PubMed).