Nuclear Factor (erythroid-Derived 2)-Like 2 (NFE2L2) antibody

Antigen: Nuclear Factor (erythroid-Derived 2)-Like 2 (NFE2L2)

Synonyms: NRF2, Nrf2, AI194320, wu:fc15g09, wu:fj67e03, MGC84750

Clonality: Polyclonal

Host: Rabbit

Reactivity: Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Chicken, Xenopus laevis

Application: Western Blotting (WB)

Catalog no.: ABIN183702

Additional Information

Alternative name: NFE2L2

Gene ID: NFE2L2

UniProt: Q16236

Immunogen: The immunogen for anti-NFE2L2 antibody: synthetic peptide directed towards the C terminal of human NFE2L2

Sequence: KEKGENDKSLHLLKKQLSTLYLEVFSMLRDEDGKPYSPSE YSLQQTRDGN

Cross-Reactivity: Cow (Bovine), Dog (Canine), Chicken, Human, Mouse (Murine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 100 µl of distilled water. Final anti-NFE2L2 antibody concentration is 1 mg/ml.

Description: NFE2 (MIM 601490), NFE2L1 (MIM 163260), and NFE2L2 comprise a family of human genes encoding basic leucine zipper (bZIP) transcription factors. They share highly conserved regions that are distinct from other bZIP families, such as JUN (MIM 165160) and FOS (MIM 164810), although remaining regions have diverged considerably from each other. NFE2L2 may be involved in the transcriptional activation of genes of the beta-globin cluster by mediating enhancer activity of hypersensitive site 2 of the beta-globin locus control region.NFE2 (MIM 601490), NFE2L1 (MIM 163260), and NFE2L2 comprise a family of human genes encoding basic leucine zipper (bZIP) transcription factors. They share highly conserved regions that are distinct from other bZIP families, such as JUN (MIM 165160) and FOS (MIM 164810), although remaining regions have diverged considerably from each other (Chan et al., 1995).[supplied by OMIM].

Characteristics: Antigen Size: 605 amino acids

Molecular Weight: 68kDa

Application Details

Application Notes: WB Suggested Anti-NFE2L2 Antibody Titration: 1.25ug/ml
ELISA Titer: 1:1562500
Positive Control: A172 cell lysate.

Purification: Protein A purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Restrictions: For Research Use only

Images

WB Suggested Anti-NFE2L2 Antibody Titration: 1.25ug/ml
ELISA Titer: 1:1562500
Positive Control: A172 cell lysate

Publications

Product: Padmanabhan, Tong, Ohta et al.: "Structural basis for defects of Keap1 activity provoked by its point mutations in lung cancer." in: Molecular cell, Vol. 21, Issue 5, pp. 689-700, 2006 (PubMed).