Nuclear Transcription Factor Y, beta (NFYB) antibody

Antigen: Nuclear Transcription Factor Y, beta (NFYB)

Synonyms: HAP3, CBF-A, CBF-B, NF-YB, NFYB, zgc:110533, zgc:110552, hap3, cbf-a, cbf-b

Clonality: Polyclonal

Host: Rabbit

Reactivity: Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Chicken, Xenopus laevis

Application: Western Blotting (WB)

Catalog no.: ABIN183703

Additional Information

Alternative name: NFYB

Gene ID: NFYB

UniProt: P25208

Immunogen: The immunogen for anti-NFYB antibody: synthetic peptide directed towards the N terminal of human NFYB

Sequence: MTMDGDSSTTDASQLGISADYIGGSHYVIQPHDDTEDSMN DHEDTNGSKE

Cross-Reactivity: Cow (Bovine), Dog (Canine), Chicken, Human, Mouse (Murine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-NFYB antibody concentration is 1 mg/ml.

Description: NFYB is one subunit of a trimeric complex, forming a highly conserved transcription factor that binds with high specificity to CCAAT motifs in the promoter regions in a variety of genes. This gene product, subunit B, forms a tight dimer with the C subunit, a prerequisite for subunit A association. The resulting trimer binds to DNA with high specificity and affinity. Subunits B and C each contain a histone-like motif. Observation of the histone nature of these subunits is supported by two types of evidence, protein sequence alignments and experiments with mutants.The protein encoded by this gene is one subunit of a trimeric complex, forming a highly conserved transcription factor that binds with high specificity to CCAAT motifs in the promoter regions in a variety of genes. This gene product, subunit B, forms a tight dimer with the C subunit, a prerequisite for subunit A association. The resulting trimer binds to DNA with high specificity and affinity. Subunits B and C each contain a histone-like motif. Observation of the histone nature of these subunits is supported by two types of evidence, protein sequence alignments and experiments with mutants.

Characteristics: Antigen Size: 207 amino acids

Molecular Weight: 23kDa

Application Details

Application Notes: WB Suggested Anti-NFYB Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Transfected 293T.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Research Area: Chromatin and Nuclear Signaling, Transcription Factors

Restrictions: For Research Use only

Images

WB Suggested Anti-NFYB Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Transfected 293T

Publications

Product: Kimura, Wakamatsu, Suzuki et al.: "Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes." in: Genome research, Vol. 16, Issue 1, pp. 55-65, 2006 (PubMed).

Lazrek, Goffard, Schanen et al.: "Detection of hepatitis C virus antibodies and RNA among medicolegal autopsy cases in Northern France." in: Diagnostic microbiology and infectious disease, Vol. 55, Issue 1, pp. 55-8, 2006 (PubMed).