Transcriptional Adaptor 3 (TADA3) antibody

Antigen: Transcriptional Adaptor 3 (TADA3)

Synonyms: ADA3, NGG1, hADA3, TADA3L, FLJ20221, FLJ21329, Tada3, MGC114459

Clonality: Polyclonal

Host: Rabbit

Reactivity: Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Zebrafish, Chicken, Xenopus laevis

Conjugate: Un-conjugated

Application: Western Blotting (WB)

Catalog no.: ABIN183709

Additional Information

Alternative name: TADA3L

Gene ID: TADA3L

UniProt: O75528

Immunogen: The immunogen for anti-TADA3L antibody: synthetic peptide directed towards the N terminal of human TADA3L

Sequence: MSELKDCPLQFHDFKSVDHLKVCPRYTAVLARSEDDGIGI EELDTLQLEL

Cross-Reactivity: Cow (Bovine), Dog (Canine), Chicken, Human, Mouse (Murine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-TADA3L antibody concentration is 1 mg/ml.

Description: Many DNA-binding transcriptional activator proteins enhance the initiation rate of RNA polymerase II-mediated gene transcription by interacting functionally with the general transcription machinery bound at the basal promoter. Adaptor proteins are usually

Characteristics: Antigen Size: 432 amino acids

Molecular Weight: 49kDa

Application Details

Application Notes: WB Suggested Anti-TADA3L Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: Transfected 293T.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Restrictions: For Research Use only

Images

WB Suggested Anti-TADA3L Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: Transfected 293T

Publications

Product: Rual, Venkatesan, Hao et al.: "Towards a proteome-scale map of the human protein-protein interaction network." in: Nature, Vol. 437, Issue 7062, pp. 1173-8, 2005 (PubMed).