Add to Basket Bulk discount
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

Tripartite Motif Containing 38 (TRIM38) antibody

Antigen

Tripartite Motif Containing 38 (TRIM38)
Synonyms RNF15, RORET, MGC8946, Gm23, TRIM38, MGC128967
Clonality Polyclonal
Host
Alternatives

Rabbit
Reactivity
Alternatives

Human
Conjugate
Alternatives Un-conjugated
Application
Alternatives Western Blotting (WB)
1 reference available
Catalog no. ABIN183711
Quantity 0.1 mg  (Variants)
Price 251.90 $   Plus shipping costs $45.00
Bulk discount
Shipping to
Availability Will be delivered in 2 to 3 Business Days

anti-Tripartite Motif Containing 38 (TRIM38) antibody

Additional Information
Application Details Publications Images Alternatives Variants back to top

Alternative name TRIM38 / RNF15
Gene ID TRIM38
UniProt O00635
Immunogen The immunogen for anti-TRIM38 antibody: synthetic peptide directed towards the N terminal of human TRIM38
Sequence MASTTSTKKMMEEATCSICLSLMTNPVSINCGHSYCHLCI TDFFKNPSQK
Cross-Reactivity Human
Format Lyophilized
Reconstitution Add 100 µl of distilled water. Final anti-TRIM38 antibody concentration is 1 mg/ml.
Description TRIM38 is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. The function of this protein has not been identified.The protein encoded by this gene is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. The function of this protein has not been identified.
Characteristics Antigen Size: 465 amino acids
Molecular Weight 53kDa

Application Details
Publications Images Alternatives Variants back to top

Application Notes WB Suggested Anti-TRIM38 Antibody Titration: 5.0ug/ml
ELISA Titer: 1:1562500
Positive Control: HepG2 cell lysate.
Purification Protein A purified
Buffer PBS
Storage (Long Term) For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Storage (Short Term) Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.
Restrictions For Research Use only

Publications
Application Details Images Alternatives Variants back to top

Product Matsuda, Suzuki, Honda et al.: "Large-scale identification and characterization of human genes that activate NF-kappaB and MAPK signaling pathways." in: Oncogene, Vol. 22, Issue 21, pp. 3307-18, 2003 (PubMed).

Alternatives
Application Details Publications Images Variants back to top

Alternatives for antigen "Tripartite Motif Containing 38 (TRIM38)", type "Antibodies"
Hosts Rabbit (35), Mouse (2)
Reactivities Human (36), Mouse (Murine) (20), Rat (Rattus) (19), Cow (Bovine) (1)
Applications Western Blotting (WB) (19), Immunofluorescence (IF) (15), ELISA (11), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) (4), Immunohistochemistry (Formalin-fixed Sections) (IHC (f)) (3), Immunoelectron Microscopy (IEM) (1), Immunohistochemistry (IHC) (1)
Conjugates Alexa Fluor 350 (1), Alexa Fluor 488 (1), Alexa Fluor 555 (1), Alexa Fluor 647 (1), Biotin (1), Cy3 (1), Cy5 (1), Cy5.5 (1), Cy7 (1), FITC (1), Gold (1), HRP (1), PE (1), PE-Cy3 (1), PE-Cy5 (1), PE-Cy5.5 (1), PE-Cy7 (1), Un-conjugated (1)
Epitopes Internal Region (3), N-Term (2), C-Term (1)