K(lysine) Acetyltransferase 5 (KAT5) antibody

Antigen: K(lysine) Acetyltransferase 5 (KAT5)

Synonyms: PLIP, 60kDa, Tip55, Tip60, Htatip, Htatip1, AI839539, MGC117972, MGC95167, TIP, ESA1, TIP60, cPLA2, HTATIP, HTATIP1, 6121, CG6121, DmEG0007.7, Dmel/TIP60, DmelCG6121, DmelTIP60, dmHAG405, dTip60, dTIP60, EG0007.7, EG:EG0007.7

Clonality: Polyclonal

Host: Rabbit

Reactivity: Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Chicken, Zebrafish

Conjugate: Un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Catalog no.: ABIN183712

Additional Information

Alternative name: KAT5

Gene ID: HTATIP

UniProt: Q92993-3

Immunogen: The immunogen for anti-HTATIP antibody: synthetic peptide directed towards the N terminal of human HTATIP

Sequence: EGCRLPVLRRNQDNEDEWPLAEILSVKDISGRKLFYVHYI DFNKRLDEWV

Cross-Reactivity: Cow (Bovine), Dog (Canine), Chicken, Human, Mouse (Murine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-HTATIP antibody concentration is 1 mg/ml.

Description: HTATIP belongs to the MYST family of histone acetyl transferases (HATs) and was originally isolated as an HIV-1 TAT-interactive protein. HATs play important roles in regulating chromatin remodeling, transcription and other nuclear processes by acetylating histone and nonhistone proteins. This protein is a histone acetylase that has a role in DNA repair and apoptosis and is thought to play an important role in signal transduction.The protein encoded by this gene belongs to the MYST family of histone acetyl transferases (HATs) and was originally isolated as an HIV-1 TAT-interactive protein. HATs play important roles in regulating chromatin remodeling, transcription and other nuclear processes by acetylating histone and nonhistone proteins. This protein is a histone acetylase that has a role in DNA repair and apoptosis and is thought to play an important role in signal transduction. Alternative splicing of this gene results in multiple transcript variants.

Characteristics: Antigen Size: 546 amino acids

Molecular Weight: 62kDa

Synonyms: PLIP, 60kDa, Tip55, Tip60, Htatip, Htatip1, AI839539, MGC117972, MGC95167, TIP, ESA1, TIP60, cPLA2, HTATIP, HTATIP1, 6121, CG6121, DmEG0007.7, Dmel/TIP60, DmelCG6121, DmelTIP60, dmHAG405, dTip60, dTIP60, EG0007.7, EG:EG0007.7

Application Details

Application Notes: WB Suggested Anti-HTATIP Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Transfected 293T.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Restrictions: For Research Use only

Images

WB Suggested Anti-HTATIP Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Transfected 293T

anti-K(lysine) Acetyltransferase 5 (KAT5) antibody (Image 2)

Publications

Product: Murr, Loizou, Yang et al.: "Histone acetylation by Trrap-Tip60 modulates loading of repair proteins and repair of DNA double-strand breaks." in: Nature cell biology, Vol. 8, Issue 1, pp. 91-9, 2006 (PubMed).