Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN183729

Zinc Finger Protein 197 (ZNF197) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms D3S1363E, P18, VHLaK, ZKSCAN9, ZNF166, ZNF20, ZSCAN41, ZNF197
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Dog (Canine), Cow (Bovine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB), Immunohistochemistry (IHC)
Pubmed 1 reference available
Catalog no. ABIN183729
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-ZNF197 antibody: synthetic peptide directed towards the N terminal of human ZNF197
Sequence MTRENVAHNALRQEGLVKGKDDTWKWGTSFQGSSSSVWET SHLHFRQLRY
Predicted Reactivity Bovine : 100%, Dog : 100%, Horse : 100%, Human : 100%
Characteristics This is a rabbit polyclonal antibody against ZNF197. It was validated on Western Blot and immunohistochemistry. We manufacture rabbit polyclonal antibodies on a large scale of high throughput manner. Our antibodies are peptide based and protein family oriented.
Purification Affinity Purified
Alternative Name ZNF197
Background ZNF197 belongs to the zinc finger protein superfamily, members of which are regulatory proteins characterized by nucleic acid-binding zinc finger domains. The protein contains 20 tandemly arrayed C2H2-type zinc fingers, a Kruppel-associated box (KRAB) domain, and a SCAN box. This transcript turns over rapidly and contains 3' UTR AUUUA motifs, which are often a hallmark of rapid turnover. It is overexpressed in some thyroid papillary carcinomas.This gene product belongs to the zinc finger protein superfamily, members of which are regulatory proteins characterized by nucleic acid-binding zinc finger domains. The encoded protein contains 20 tandemly arrayed C2H2-type zinc fingers, a Kruppel-associated box (KRAB) domain, and a SCAN box. This transcript turns over rapidly and contains 3' UTR AUUUA motifs, which are often a hallmark of rapid turnover. It is overexpressed in some thyroid papillary carcinomas. This gene is located in a cluster of zinc finger genes at 3p21. Two alternatively spliced transcripts encoding different isoforms have been described.
Molecular Weight 29kDa
Gene ID 10168
NCBI Accession NP_001020026, NM_001024855
UniProt Q86VG0
Research Area Chromatin and Nuclear Signaling, Transcription Factors
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-ZNF197 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Li, Wang, Na et al.: "The VHL protein recruits a novel KRAB-A domain protein to repress HIF-1alpha transcriptional activity." in: The EMBO journal, Vol. 22, Issue 8, pp. 1857-67, 2003 (PubMed).

Alternatives for antigen "Zinc Finger Protein 197 (ZNF197)", type "Antibodies"
Hosts (9), (1)
Reactivities (10), (2), (1)
Applications (10), (4), (4), (2)
Epitopes (7), (2), (2), (1), (1), (1)
Beacon