Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN183749

IKAROS Family Zinc Finger 3 (Aiolos) (IKZF3) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms AIO, AIOLOS, ZNFN1A3, 5830411O07Rik, Aiolos, Zfpn1a3, Znfn1a3, aio, aiolos, znfn1a3
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Cow (Bovine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB), Immunohistochemistry (IHC)
Pubmed 1 reference available
Catalog no. ABIN183749
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-IKZF3 antibody: synthetic peptide directed towards the N terminal of human IKZF3
Sequence KSTQEQSVPAESAAVLNDYSLTKSHEMENVDSGEGPANED EDIGDDSMKV
Predicted Reactivity Human : 100%, Bovine : 85%, Mouse : 85%, Rabbit : 85%, Rat : 78%
Characteristics This is a rabbit polyclonal antibody against IKZF3. It was validated on Western Blot and immunohistochemistry. We manufacture rabbit polyclonal antibodies on a large scale of high throughput manner. Our antibodies are peptide based and protein family oriented.
Purification Affinity Purified
Alternative Name IKZF3
Background IKZF3 is a member of the Ikaros family of zinc-finger proteins. It is a transcription factor that is important in the regulation of B lymphocyte proliferation and differentiation. Both Ikaros and Aiolos can participate in chromatin remodeling. Regulation of gene expression in B lymphocytes by Aiolos is complex as it appears to require the sequential formation of Ikaros homodimers, Ikaros/Aiolos heterodimers, and Aiolos homodimers.This gene encodes a member of the Ikaros family of zinc-finger proteins. Three members of this protein family (Ikaros, Aiolos and Helios) are hematopoetic-specific transcription factors involved in the regulation of lymphocyte development. This gene product is a transcription factor that is important in the regulation of B lymphocyte proliferation and differentiation. Both Ikaros and Aiolos can participate in chromatin remodeling. Regulation of gene expression in B lymphocytes by Aiolos is complex as it appears to require the sequential formation of Ikaros homodimers, Ikaros/Aiolos heterodimers, and Aiolos homodimers. At least six alternative transcripts encoding different isoforms have been described.
Molecular Weight 52kDa
Gene ID 22806
NCBI Accession NP_899051, NM_183228
UniProt Q9UKT9-2
Research Area Chromatin and Nuclear Signaling, Transcription Factors
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-IKZF3 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Koipally, Georgopoulos: "A molecular dissection of the repression circuitry of Ikaros." in: The Journal of biological chemistry, Vol. 277, Issue 31, pp. 27697-705, 2002 (PubMed).

Alternatives for antigen "IKAROS Family Zinc Finger 3 (Aiolos) (IKZF3)", type "Antibodies"
Hosts (34), (6)
Reactivities (41), (23), (15), (13), (13), (13), (12), (2), (1), (1)
Applications (29), (16), (10), (8), (2), (2), (1), (1), (1)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (4), (3), (3), (2), (2), (1), (1), (1), (1), (1), (1)
Beacon