RBBP2H1 / JARID1B antibody

Antigen: RBBP2H1 / JARID1B

Clonality: Polyclonal

Host: Rabbit

Reactivity: Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Xenopus laevis, Chicken, Fruit Fly (Drosophila melanogaster)

Application: Western Blotting (WB)

Catalog no.: ABIN183776

Additional Information

Gene ID: JMJD1B

UniProt: Q7LBC6

Immunogen: The immunogen for anti-JMJD1B antibody: synthetic peptide directed towards the C terminal of human JMJD1B

Sequence: VHNLYSCIKVAEDFVSPEHVKHCFRLTQEFRHLSNTHTNH EDKLQVKNII

Cross-Reactivity: Cow (Bovine), Dog (Canine), Chicken, Fruit Fly (Drosophila melanogaster), Human, Mouse (Murine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 100 µl of distilled water. Final anti-JMJD1B antibody concentration is 1 mg/ml.

Description: JMJD1B contains a highly-conserved C-terminus containing a zinc finger with the unique spacing Cys-X2-Cys-X7-His-X2-Cys-X2-Cys-X4-Cys-X2-Cys and a jmjC domain. It plays an important role in histone demethylation and may be a candidate for tumor suppressors.

Characteristics: Antigen Size: 1761 amino acids

Molecular Weight: 192kDa

Application Details

Application Notes: WB Suggested Anti-JMJD1B Antibody Titration: 2.5ug/ml
ELISA Titer: 1:12500
Positive Control: Human Thymus.

Purification: Protein A purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Restrictions: For Research Use only

Images

WB Suggested Anti-JMJD1B Antibody Titration: 2.5ug/ml
ELISA Titer: 1:12500
Positive Control: Human Thymus

Publications

Product: Hu, Gomes, Horrigan et al.: "A novel nuclear protein, 5qNCA (LOC51780) is a candidate for the myeloid leukemia tumor suppressor gene on chromosome 5 band q31." in: Oncogene, Vol. 20, Issue 47, pp. 6946-54, 2001 (PubMed).