Zinc Finger Protein 64 (Isoform 1,Isoform 2) antibody

Antigen: Zinc Finger Protein 64

Synonyms: znf64, znf338

Binding Site: Isoform 1,Isoform 2

Clonality: Polyclonal

Host: Rabbit

Reactivity: Cow (Bovine), Human, Pig (Porcine), Dog (Canine)

Application: Western Blotting (WB)

Catalog no.: ABIN183783

Additional Information

Alternative name: ZFP64

Gene ID: ZFP64

UniProt: Q9NPA5-2

Immunogen: The immunogen for anti-ZFP64 antibody: synthetic peptide directed towards the N terminal of human ZFP64

Sequence: MNASSEGESFAGSVQIPGGTTVLVELTPDIHICGICKQQF NNLDAFVAHK

Cross-Reactivity: Cow (Bovine), Dog (Canine), Human, Pig (Porcine)

Format: Lyophilized

Reconstitution: Add 100 µl of distilled water. Final anti-ZFP64 antibody concentration is 1 mg/ml.

Description: ZFP64 belongs to the krueppel C2H2-type zinc-finger protein family. It contains 9 C2H2-type zinc fingers and may be involved in transcriptional regulation.

Characteristics: Antigen Size: 627 amino acids

Molecular Weight: 69kDa

Application Details

Application Notes: WB Suggested Anti-ZFP64 Antibody Titration: 2.5ug/ml
ELISA Titer: 1:62500
Positive Control: Transfected 293T.

Purification: Protein A purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Restrictions: For Research Use only

Images

WB Suggested Anti-ZFP64 Antibody Titration: 2.5ug/ml
ELISA Titer: 1:62500
Positive Control: Transfected 293T

Publications

Product: Suzuki, Yoshitomo-Nakagawa, Maruyama et al.: "Construction and characterization of a full length-enriched and a 5'-end-enriched cDNA library." in: Gene, Vol. 200, Issue 1-2, pp. 149-56, 1997 (PubMed).