Add to Basket Bulk discount
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

Zinc Finger Protein 64 (Isoform 1,Isoform 2) antibody

Antigen

Zinc Finger Protein 64

Synonyms znf64, znf338
Binding Site
Alternatives

Isoform 1,Isoform 2

Clonality Polyclonal
Host
Alternatives

Rabbit

Reactivity
Alternatives

Cow (Bovine), Human, Rat (Rattus), Dog (Canine), Mouse (Murine), Pig (Porcine), Chicken

Application
Alternatives Western Blotting (WB)
1 reference available
Catalog no. ABIN183784
Quantity 0.1 mg  (Variants)
Price 251.90 $   Plus shipping costs $45.00
Bulk discount
Shipping to
Availability Will be delivered in 2 to 3 Business Days

Additional Information

Alternative name ZFP64
Gene ID ZFP64
UniProt Q9NPA5-2
Immunogen The immunogen for anti-ZFP64 antibody: synthetic peptide directed towards the C terminal of human ZFP64
Sequence SDGGQNIAVATTAPPVFSSSSQQELPKQTYSIIQGAAHPA LLCPADSIPD
Cross-Reactivity Cow (Bovine), Dog (Canine), Chicken, Human, Mouse (Murine), Pig (Porcine), Rat (Rattus)
Format Lyophilized
Reconstitution Add 100 µl of distilled water. Final anti-ZFP64 antibody concentration is 1 mg/ml.
Description ZFP64 belongs to the krueppel C2H2-type zinc-finger protein family. It contains 9 C2H2-type zinc fingers and may be involved in transcriptional regulation.
Characteristics Antigen Size: 627 amino acids
Molecular Weight 69kDa

Application Details

Application Notes WB Suggested Anti-ZFP64 Antibody Titration: 1.25ug/ml
ELISA Titer: 1:1562500
Positive Control: Transfected 293T.
Purification Protein A purified
Buffer PBS
Storage (Long Term) For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Storage (Short Term) Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.
Restrictions For Research Use only

Publications

Product Suzuki, Yoshitomo-Nakagawa, Maruyama et al.: "Construction and characterization of a full length-enriched and a 5'-end-enriched cDNA library." in: Gene, Vol. 200, Issue 1-2, pp. 149-56, 1997 (PubMed).

Alternatives

Alternatives for antigen "Zinc Finger Protein 64", type "Antibodies"
Hosts Rabbit (16)
Reactivities Human (16), Mouse (Murine) (7), Rat (Rattus) (7), Dog (Canine) (5), Cow (Bovine) (4), Pig (Porcine) (4), Chicken (3), Cat (Feline) (1)
Applications Western Blotting (WB) (16), ELISA (9), Immunofluorescence (IF) (2), Immunohistochemistry (IHC) (2), Immunocytochemistry (ICC) (1), Immunoprecipitation (IP) (1)
Epitopes Isoform 1,Isoform 2 (2), N-Term (2), C-Term (1), C-Term,AA 524-551 (1), Internal Region (1), Isoform 3,Isoform 4 (1)