Add to Basket Bulk discount
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

Kelch-Like 26 (Drosophila) (KLHL26) antibody

Antigen

Kelch-Like 26 (Drosophila) (KLHL26)

Synonyms FLJ11078, Klkl26, MGC38024, C630013N10Rik, RGD1312034, KIAA0469, MGC153248, wu:fi20e10, wu:fi28a03, zgc:153248, si:ch211-255d18.7
Clonality Polyclonal
Host
Alternatives

Rabbit

Reactivity
Alternatives

Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Chicken, Zebrafish

Conjugate
Alternatives Un-conjugated
Application
Alternatives Western Blotting (WB)
1 reference available
Catalog no. ABIN183787
Quantity 0.1 mg  (Variants)
Price 251.90 $   Plus shipping costs $45.00
Bulk discount
Shipping to
Availability Will be delivered in 2 to 3 Business Days

Additional Information

Alternative name Kelch-like protein 26
Gene ID KLHL26
UniProt Q53HC5
Immunogen The immunogen for anti-KLHL26 antibody: synthetic peptide directed towards the C terminal of human KLHL26
Sequence EAGCCLLERKIYIVGGYNWRLNNVTGIVQVYNTDTDEWER DLHFPESFAG
Cross-Reactivity Cow (Bovine), Chicken, Human, Mouse (Murine), Rat (Rattus)
Format Lyophilized
Reconstitution Add 100 µl of distilled water. Final anti-KLHL26 antibody concentration is 1 mg/ml.
Description The function of KLHL26 remains unknown.
Characteristics Antigen Size: 615 amino acids
Molecular Weight 68kDa

Application Details

Application Notes WB Suggested Anti-KLHL26 Antibody Titration: 1.25ug/ml
ELISA Titer: 1:1562500
Positive Control: Jurkat cell lysate.
Purification Protein A purified
Buffer PBS
Storage (Long Term) For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Storage (Short Term) Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.
Restrictions For Research Use only

Publications

Product Suzuki, Yoshitomo-Nakagawa, Maruyama et al.: "Construction and characterization of a full length-enriched and a 5'-end-enriched cDNA library." in: Gene, Vol. 200, Issue 1-2, pp. 149-56, 1997 (PubMed).

Alternatives

Alternatives for antigen "Kelch-Like 26 (Drosophila) (KLHL26)", type "Antibodies"
Hosts Rabbit (22)
Reactivities Human (22), Cow (Bovine) (18), Mouse (Murine) (18), Rat (Rattus) (18), Chicken (17), Zebrafish (1)
Applications Immunofluorescence (IF) (14), Western Blotting (WB) (7), ELISA (2), Immunohistochemistry (Formalin-fixed Sections) (IHC (f)) (2), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) (2), Immunoelectron Microscopy (IEM) (1)
Conjugates Alexa Fluor 350 (1), Alexa Fluor 488 (1), Alexa Fluor 555 (1), Alexa Fluor 647 (1), Biotin (1), Cy3 (1), Cy5 (1), Cy5.5 (1), Cy7 (1), FITC (1), Gold (1), HRP (1), PE (1), PE,Cy3 (1), PE,Cy5 (1), PE,Cy5.5 (1), PE,Cy7 (1)
Epitopes C-Term (1), Internal Region (1), N-Term (1)