DCP1 Decapping Enzyme Homolog A (S. Cerevisiae) (DCP1A) antibody

Antigen: DCP1 Decapping Enzyme Homolog A (S. Cerevisiae) (DCP1A)

Synonyms: SMIF, FLJ21691, SMAD4IP1, HSA275986, Nbla00360, Mitc1, AU019772, D14Ertd817e, 1110066A22Rik, 4930568L04Rik, RGD1561298, DCP1A, MGC159576

Clonality: Polyclonal

Host: Rabbit

Reactivity: Cow (Bovine), Human, Dog (Canine), Mouse (Murine), Rat (Rattus), Chicken, Xenopus laevis, Zebrafish

Application: Western Blotting (WB)

Catalog no.: ABIN183789

Additional Information

Alternative name: DCP1A

Gene ID: DCP1A

UniProt: Q9NPI6

Immunogen: The immunogen for anti-DCP1A antibody: synthetic peptide directed towards the N terminal of human DCP1A

Sequence: MEALSRAGQEMSLAALKQHDPYITSIADLTGQVALYTFCP KANQWEKTDI

Cross-Reactivity: Cow (Bovine), Dog (Canine), Chicken, Human, Mouse (Murine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 100 µl of distilled water. Final anti-DCP1A antibody concentration is 1 mg/ml.

Description: Decapping is a key step in general and regulated mRNA decay. The protein encoded by this gene is a decapping enzyme. This protein and another decapping enzyme form a decapping complex, which interacts with the nonsense-mediated decay factor hUpf1 and may be recruited to mRNAs containing premature termination codons. This protein also participates in the TGF-beta signaling pathway.Decapping is a key step in general and regulated mRNA decay. The protein encoded by this gene is a decapping enzyme. This protein and another decapping enzyme form a decapping complex, which interacts with the nonsense-mediated decay factor hUpf1 and may be recruited to mRNAs containing premature termination codons. This protein also participates in the TGF-beta signaling pathway.

Characteristics: Antigen Size: 515 amino acids

Molecular Weight: 56kDa

Application Details

Application Notes: WB Suggested Anti-DCP1A Antibody Titration: 1.25ug/ml
ELISA Titer: 1:312500
Positive Control: Jurkat cell lysate.

Purification: Protein A purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Restrictions: For Research Use only

Images

WB Suggested Anti-DCP1A Antibody Titration: 1.25ug/ml
ELISA Titer: 1:312500
Positive Control: Jurkat cell lysate

Publications

Product: Lehner, Sanderson: "A protein interaction framework for human mRNA degradation." in: Genome research, Vol. 14, Issue 7, pp. 1315-23, 2004 (PubMed).