Add to Basket Bulk discount
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

Unconventional SNARE in The ER 1 Homolog (S. Cerevisiae) (Use1) antibody

Antigen

Unconventional SNARE in The ER 1 Homolog (S. Cerevisiae) (Use1)

Synonyms P31, SLT1, MDS032, D12, Ed2, p31, Q-snare, AV002165, 2010315L10Rik, 5730403H22Rik, use1, fj43b06, MGC56402, wu:fj43b06, MGC140764, GB16719
Clonality Polyclonal
Host
Alternatives

Rabbit

Reactivity
Alternatives

Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Chicken, Zebrafish

Application
Alternatives Western Blotting (WB), Immunohistochemistry (IHC)
1 reference available
Catalog no. ABIN183790
Quantity 50 µg  (Variants)
Price 317.90 $   Plus shipping costs $45.00
Bulk discount
Shipping to
Availability Will be delivered in 2 to 3 Business Days

Additional Information

Alternative name USE1
Gene ID MDS032
UniProt Q9NZ43
Immunogen The immunogen for anti-MDS032 antibody: synthetic peptide directed towards the N terminal of human MDS032
Sequence ELNLVRLLSRCEAMAAEKRDPDEWRLEKYVGALEDMLQAL KVHASKPASE
Cross-Reactivity Cow (Bovine), Dog (Canine), Chicken, Human, Mouse (Murine), Rat (Rattus)
Format Lyophilized
Reconstitution Add 50 µl of distilled water. Final anti-MDS032 antibody concentration is 1 mg/ml.
Description MDS032 belongs to the USE1 family and is a component of a SNARE complex which may be involved in targeting and fusion of Golgi-derived retrograde transport vesicles with the ER.
Characteristics Antigen Size: 259 amino acids
Molecular Weight 29kDa

Application Details

Application Notes WB Suggested Anti-MDS032 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Jurkat cell lysate.
Purification Affinity Purified
Buffer PBS
Storage (Long Term) For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Storage (Short Term) Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.
Restrictions For Research Use only

Publications

Product Matsuda, Suzuki, Honda et al.: "Large-scale identification and characterization of human genes that activate NF-kappaB and MAPK signaling pathways." in: Oncogene, Vol. 22, Issue 21, pp. 3307-18, 2003 (PubMed).

Alternatives

Alternatives for antigen "Unconventional SNARE in The ER 1 Homolog (S. Cerevisiae) (Use1)", type "Antibodies"
Hosts Rabbit (16), Mouse (2)
Reactivities Human (9), Mouse (Murine) (9), Cow (Bovine) (3), Dog (Canine) (3), Rat (Rattus) (3), Xenopus laevis (3), Zebrafish (2), Chicken (1)
Applications Western Blotting (WB) (18), Immunohistochemistry (IHC) (6), ELISA (5)
Epitopes N-Term (4), Internal Region (3), N-Term,AA 8-35 (1)