Add to Basket Bulk discount
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

Deformed Epidermal Autoregulatory Factor 1 (Drosophila) (DEAF1) antibody

Antigen

Deformed Epidermal Autoregulatory Factor 1 (Drosophila) (DEAF1)
Synonyms DEAF1, spn, NUDR, MYND5, AU042387, C230009B13Rik, SPN, ZMYND5, nudr, zmynd5
Clonality Polyclonal
Host
Alternatives

Rabbit
Reactivity
Alternatives

Dog (Canine), Human, Mouse (Murine), Rat (Rattus), Chicken
Conjugate
Alternatives Un-conjugated
Application
Alternatives Western Blotting (WB)
1 reference available
Catalog no. ABIN183800
Quantity 50 µg  (Variants)
Price 317.90 $   Plus shipping costs $45.00
Bulk discount
Shipping to
Availability Will be delivered in 2 to 3 Business Days

anti-Deformed Epidermal Autoregulatory Factor 1 (Drosophila) (DEAF1) antibody

Additional Information
Application Details Publications Images Alternatives Variants back to top

Alternative name DEAF1
Gene ID DEAF1
UniProt O75398
Immunogen The immunogen for anti-DEAF1 antibody: synthetic peptide directed towards the C terminal of human DEAF1
Sequence TGCHKVNYCSTFCQRKDWKDHQHICGQSAAVTVQADEVHV AESVMEKVTV
Cross-Reactivity Dog (Canine), Chicken, Human, Mouse (Murine), Rat (Rattus)
Format Lyophilized
Reconstitution Add 50 µl of distilled water. Final anti-DEAF1 antibody concentration is 1 mg/ml.
Description DEAF1 down-regulates transcription of those genes by binding to sequence with multiple copies of TTC[CG]G present in their own promoter and that of the HNRPA2B1 gene. DEAF1 binds to the retinoic acid response element (RARE) AGGGTTCACCGAAAGTTCA. DEAF1 activates the proenkephalin gene independently of promoter binding, probably through protein-protein interaction. When secreted, behaves as an inhibitor of cell proliferation, by arresting cells in the G0 or G1 phase.
Characteristics Antigen Size: 565 amino acids
Molecular Weight 59kDa

Application Details
Publications Images Alternatives Variants back to top

Application Notes WB Suggested Anti-DEAF1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Jurkat cell lysate.
Purification Affinity Purified
Buffer PBS
Storage (Long Term) For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Storage (Short Term) Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.
Restrictions For Research Use only

Publications
Application Details Images Alternatives Variants back to top

Product Czesak, Lemonde, Peterson et al.: "Cell-specific repressor or enhancer activities of Deaf-1 at a serotonin 1A receptor gene polymorphism." in: The Journal of neuroscience : the official journal of the Society for Neuroscience, Vol. 26, Issue 6, pp. 1864-71, 2006 (PubMed).

Alternatives
Application Details Publications Images Variants back to top

Alternatives for antigen "Deformed Epidermal Autoregulatory Factor 1 (Drosophila) (DEAF1)", type "Antibodies"
Hosts Rabbit (29), Mouse (6)
Reactivities Mouse (Murine) (24), Rat (Rattus) (21), Dog (Canine) (19), Chicken (18), Cow (Bovine) (18), Horse (Equine) (17), Human (16), Cat (Feline) (1), Fruit Fly (Drosophila melanogaster) (1)
Applications Western Blotting (WB) (18), ELISA (15), Immunofluorescence (IF) (15), Immunohistochemistry (IHC) (4), Immunohistochemistry (Formalin-fixed Sections) (IHC (f)) (2), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) (2), Dot Blot (Dot) (1), Immunoelectron Microscopy (IEM) (1), Immunoprecipitation (IP) (1)
Conjugates Alexa Fluor 350 (1), Alexa Fluor 488 (1), Alexa Fluor 555 (1), Alexa Fluor 647 (1), Biotin (1), Cy3 (1), Cy5 (1), Cy5.5 (1), Cy7 (1), FITC (1), Gold (1), HRP (1), PE (1), PE,Cy3 (1), PE,Cy5 (1), PE,Cy5.5 (1), PE,Cy7 (1)
Epitopes C-Term (5), N-Term (1)