Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN183802

Zinc Finger Protein 253 (ZNF253) (C-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms BMZF-1, BMZF1, ZNF411, ZNF253
Epitope
»Alternatives C-Term
Reactivity
»Alternatives Cow (Bovine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN183802
Quantity 100 µg
Price
229.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-ZNF253 antibody: synthetic peptide directed towards the C terminal of human ZNF253
Sequence LTTHKRIHTGEKPYKCEECGKAFNWSSDLNKHKKIHIERK PYIVKNVTDL
Predicted Reactivity Bovine :83%,   Human :100%,  
Characteristics This is a rabbit polyclonal antibody against ZNF253. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Protein A purified
Alternative Name ZNF253
Background ZNF253 may function as a transcription factor. Seem to have a transcriptional repression activity
Molecular Weight 32kDa
Gene ID 56242
NCBI Accession NP_066385, NM_021047
UniProt O75346
Research Area Chromatin and Nuclear Signaling, Transcription Factors
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-ZNF253 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Han, Zhang, Ye et al.: "Molecular cloning of six novel Krüppel-like zinc finger genes from hematopoietic cells and identification of a novel transregulatory domain KRNB." in: The Journal of biological chemistry, Vol. 274, Issue 50, pp. 35741-8, 2000 (PubMed).

Alternatives for antigen "Zinc Finger Protein 253 (ZNF253)", type "Antibodies"
Hosts (1), (1)
Reactivities (2)
Applications (1), (1)
Epitopes (1), (1)
Beacon