Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN183810

Zinc Finger Protein 70 (ZNF70) (C-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms Cos17
Epitope
»Alternatives C-Term
Reactivity
»Alternatives Dog (Canine), Rat (Rattus), Mouse (Murine), Cow (Bovine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB), Immunohistochemistry (IHC)
Pubmed 1 reference available
Catalog no. ABIN183810
Quantity 100 µg
Price
229.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-ZNF70 antibody: synthetic peptide directed towards the C terminal of human ZNF70
Sequence GKAFRHRSALIEHYKTHTREKPYVCNLCGKSFRGSSHLIR HQKIHSGEKL
Predicted Reactivity Human : 100%, Horse : 92%, Bovine : 85%
Characteristics This is a rabbit polyclonal antibody against ZNF70. It was validated on Western Blot and immunohistochemistry. We manufacture rabbit polyclonal antibodies on a large scale of high throughput manner. Our antibodies are peptide based and protein family oriented.
Purification Protein A purified
Alternative Name ZNF70
Background The function of the ZNF70 has not yet been determined
Molecular Weight 51kDa
Gene ID 7621
NCBI Accession NP_068735, NM_021916
UniProt Q9UC06
Research Area Chromatin and Nuclear Signaling, Transcription Factors
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-ZNF70 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Product cited in: Collins, Wright, Edwards et al.: "A genome annotation-driven approach to cloning the human ORFeome." in: Genome biology, Vol. 5, Issue 10, pp. R84, 2004 (PubMed).

Alternatives for antigen "Zinc Finger Protein 70 (ZNF70)", type "Antibodies"
Hosts (7), (6)
Reactivities (13), (1), (1), (1), (1)
Applications (11), (5), (3), (1), (1), (1)
Epitopes (6), (4), (2)
Beacon