Zinc Finger Protein 70 (ZNF70) (C-Term) antibody

Details for Product No. ABIN183810
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

 
Antigen
Synonyms Cos17
Epitope
C-Term
(4), (2)
Reactivity
Dog (Canine), Rat (Rattus), Mouse (Murine), Cow (Bovine), Human
(9), (1), (1), (1), (1)
Host
Rabbit
(8), (1)
Clonality
Polyclonal
Application
Immunohistochemistry (IHC), Western Blotting (WB)
(8), (3), (2), (1), (1)
Pubmed 1 reference available
Catalog no. ABIN183810
Quantity 100 µg
Price
229.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the C terminal of human ZNF70
Sequence GKAFRHRSALIEHYKTHTREKPYVCNLCGKSFRGSSHLIR HQKIHSGEKL
Predicted Reactivity Human : 100 %, Horse : 90 %, Bovine : 80 %
Characteristics This is a rabbit polyclonal antibody against ZNF70. It was validated on Western Blot and immunohistochemistry.
Purification Protein A purified
Alternative Name ZNF70
Background The function of the ZNF70 has not yet been determined
Molecular Weight 51 kDa
Gene ID 7621
NCBI Accession NM_021916, NP_068735
UniProt Q9UC06
Research Area Chromatin and Nuclear Signaling, Transcription Factors
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 446 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Zinc Finger Protein 70 (ZNF70) (C-Term) antibody WB Suggested Anti-ZNF70 Antibody Titration: 5.0ug/ml
ELISA Titer: 1:312500
Positive Control: HepG2 cell lysate
anti-Zinc Finger Protein 70 (ZNF70) (C-Term) antibody (2) anti-Zinc Finger Protein 70 (ZNF70) (C-Term) antibody (Image 2)
Product cited in: Collins, Wright, Edwards et al.: "A genome annotation-driven approach to cloning the human ORFeome." in: Genome biology, Vol. 5, Issue 10, pp. R84, 2004 (PubMed).

Hosts (8), (1)
Reactivities (9), (1), (1), (1), (1)
Applications (8), (3), (2), (1), (1)
Epitopes (4), (2)
back to top