Zinc Finger Protein 70 (ZNF70) antibody
| Antigen | Zinc Finger Protein 70 (ZNF70) |
| Synonyms | Cos17, MGC48959 |
| Clonality | Polyclonal |
| Host |
 Alternatives Rabbit |
| Reactivity |
Alternatives Cow (Bovine), Human, Dog (Canine), Rat (Rattus), Mouse (Murine) |
| Application |
Alternatives Western Blotting (WB), Immunohistochemistry (IHC) |
 |
1 reference available |
| Catalog no. | ABIN183810 |
| Quantity | 0.1 mg (Variants) |
| Price | 251.90 $ Plus shipping costs $45.00 |
| Shipping to |
|
| Availability | Will be delivered in 2 to 3 Business Days |
Additional Information
| Alternative name | ZNF70 |
| Gene ID | ZNF70 |
| UniProt | Q9UC06 |
| Immunogen | The immunogen for anti-ZNF70 antibody: synthetic peptide directed towards the C terminal of human ZNF70 |
| Sequence | GKAFRHRSALIEHYKTHTREKPYVCNLCGKSFRGSSHLIR HQKIHSGEKL |
| Cross-Reactivity | Cow (Bovine), Dog (Canine), Human, Mouse (Murine), Rat (Rattus) |
| Format | Lyophilized |
| Reconstitution | Add 100 µl of distilled water. Final anti-ZNF70 antibody concentration is 1 mg/ml. |
| Description | The function of the ZNF70 has not yet been determined |
| Characteristics | Antigen Size: 446 amino acids |
| Molecular Weight | 51kDa |
Application Details
| Application Notes |
WB Suggested Anti-ZNF70 Antibody Titration: 5.0ug/ml ELISA Titer: 1:312500 Positive Control: HepG2 cell lysate. |
| Purification | Protein A purified |
| Buffer | PBS |
| Storage (Long Term) | For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles. |
| Storage (Short Term) | Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen. |
| Research Area | Chromatin and Nuclear Signaling, Transcription Factors |
| Restrictions | For Research Use only |
Images
|
WB Suggested Anti-ZNF70 Antibody Titration: 5.0ug/ml ELISA Titer: 1:312500 Positive Control: HepG2 cell lysate anti-Zinc Finger Protein 70 (ZNF70) antibody (Image 2) |
Publications
| Product |
Collins, Wright, Edwards et al.: "A genome annotation-driven approach to cloning the human ORFeome." in: Genome biology, Vol. 5, Issue 10, pp. R84, 2004 (PubMed).
|
Alternatives
Alternatives for antigen "Zinc Finger Protein 70 (ZNF70)", type "Antibodies"
| Hosts | Rabbit (6) |
| Reactivities | Human (6), Cow (Bovine) (1), Dog (Canine) (1), Mouse (Murine) (1), Rat (Rattus) (1) |
| Applications | Western Blotting (WB) (6), Immunohistochemistry (IHC) (3), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) (1) |
| Epitopes | N-Term (2), C-Term (1) |
Sponsorship
2013 BioMed Central Research Awards
2013 BioMed Central Research Awards
