MYC-inducedgen (Nuclear) antibody

Antigen: MYC-inducedgen

Binding Site: Nuclear

Clonality: Polyclonal

Host: Rabbit

Reactivity: Human

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Catalog no.: ABIN183830

Additional Information

Gene ID: MINA

UniProt: Q8IUF6

Immunogen: The immunogen for anti-MINA antibody: synthetic peptide directed towards the N terminal of human MINA

Sequence: MPKKAKPTGSGKEEGPAPCKQMKLEAAGGPSALNFDSPSS LFESLISPIK

Cross-Reactivity: Human

Format: Lyophilized

Reconstitution: Add 100 µl of distilled water. Final anti-MINA antibody concentration is 1 mg/ml.

Description: MINA is a protein with a molecular weight of 53 kDa, which is localized in the nucleus and with part of the protein concentrated in the nucleolus. It is a direct target gene of Myc and is involved in mammalian cell proliferation.

Characteristics: Antigen Size: 280 amino acids

Molecular Weight: 32kDa

Application Details

Application Notes: WB Suggested Anti-MINA Antibody Titration: 0.25ug/ml
ELISA Titer: 1:62500
Positive Control: Human Thymus.

Purification: Protein A purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Restrictions: For Research Use only

Images

WB Suggested Anti-MINA Antibody Titration: 0.25ug/ml
ELISA Titer: 1:62500
Positive Control: Human Thymus

anti-MYC-inducedgen (Nuclear) antibody (Image 2)

Publications

Product: Zhang, Lu, Yuan et al.: "The Human mineral dust-induced gene, mdig, is a cell growth regulating gene associated with lung cancer." in: Oncogene, Vol. 24, Issue 31, pp. 4873-82, 2005 (PubMed).