MYC-inducedgen (Nuclear) antibody

Antigen: MYC-inducedgen

Binding Site: Nuclear

Clonality: Polyclonal

Host: Rabbit

Reactivity: Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Chicken

Application: Western Blotting (WB)

Catalog no.: ABIN183831

Additional Information

Gene ID: MINA

UniProt: Q96KB0

Immunogen: The immunogen for anti-MINA antibody: synthetic peptide directed towards the C terminal of human MINA

Sequence: HGLRFPLSHLDALKQIWNSPAISVKDLKLTTDEEKESLVL SLWTECLIQV

Cross-Reactivity: Cow (Bovine), Dog (Canine), Chicken, Human, Mouse (Murine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 100 µl of distilled water. Final anti-MINA antibody concentration is 1 mg/ml.

Description: MINA protein is directly involved in ribosome biogenesis, most likely during the assembly process of preribosomal particles. MINA is also involved in cell proliferation. MINA may have a role in esophageal squamous cell carcinoma, colon cancer and lung cancer

Characteristics: Antigen Size: 464 amino acids

Molecular Weight: 53kDa

Application Details

Application Notes: WB Suggested Anti-MINA Antibody Titration: 5.0ug/ml
ELISA Titer: 1:12500
Positive Control: Jurkat cell lysate.

Purification: Protein A purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Restrictions: For Research Use only

Images

WB Suggested Anti-MINA Antibody Titration: 5.0ug/ml
ELISA Titer: 1:12500
Positive Control: Jurkat cell lysate

Publications

Product: Zhang, Lu, Yuan et al.: "The Human mineral dust-induced gene, mdig, is a cell growth regulating gene associated with lung cancer." in: Oncogene, Vol. 24, Issue 31, pp. 4873-82, 2005 (PubMed).