Cyclin B3 (CCNB3) (N-Term) antibody

Details for Product No. ABIN183835
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

 
Antigen
Synonyms RGD1564367, CYCB3, CG5814, Cyc B3, Dmel\\CG5814, anon-WO0118547.414, cycB3, l(3)L6540, ccnb3-a, zgc:153369, MGC154490, NV16541, CCNB3
Epitope
N-Term
(3), (3), (3), (3), (3), (3), (3), (3), (3), (3), (3), (2), (1), (1), (1), (1)
Reactivity
Human
(28), (23), (20), (11), (11), (11)
Host
Rabbit
(47), (2)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(24), (15), (9), (4), (2), (2), (1)
Pubmed 1 reference available
Catalog no. ABIN183835
Quantity 100 µg
Price
229.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human CCNB3
Sequence MLLPLPPQSSKPVPKKSQSSKIVPSHHDPSEKTGENCQTK ISPSSLQESP
Predicted Reactivity Human : 100 %
Characteristics This is a rabbit polyclonal antibody against CCNB3. It was validated on Western Blot using a cell lysate as a positive control.
Purification Protein A purified
Alternative Name CCNB3
Background CCNB3 belongs to the highly conserved cyclin family, whose members are characterized by a dramatic periodicity in protein abundance through the cell cycle. Cyclins function as regulators of CDK kinases. Different cyclins exhibit distinct expression and degradation patterns which contribute to the temporal coordination of each mitotic event.This cyclin may associate with CDC2 and CDK2 kinases, and be required for proper spindle reorganization and restoration of the interphase nucleus.The protein encoded by this gene belongs to the highly conserved cyclin family, whose members are characterized by a dramatic periodicity in protein abundance through the cell cycle. Cyclins function as regulators of CDK kinases. Different cyclins exhibit distinct expression and degradation patterns which contribute to the temporal coordination of each mitotic event. Studies of similar genes in chick and Drosophila suggest that this cyclin may associate with CDC2 and CDK2 kinases, and be required for proper spindle reorganization and restoration of the interphase nucleus. Two transcript variants encoding different isoforms have been found for this gene.
Molecular Weight 12 kDa
Gene ID 85417
NCBI Accession NM_033671, NP_391991
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 111 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Cyclin B3 (CCNB3) (N-Term) antibody WB Suggested Anti-CCNB3 Antibody Titration: 1.25ug/ml
Positive Control: HepG2 cell lysate
Background publications Nguyen, Manova, Capodieci et al.: "Characterization and expression of mammalian cyclin b3, a prepachytene meiotic cyclin." in: The Journal of biological chemistry, Vol. 277, Issue 44, pp. 41960-9, 2002 (PubMed).

Hosts (47), (2)
Reactivities (28), (23), (20), (11), (11), (11)
Applications (24), (15), (9), (4), (2), (2), (1)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (3), (3), (3), (3), (3), (3), (3), (3), (3), (3), (3), (2), (1), (1), (1), (1)
back to top