Add to Basket Bulk discount
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

Nucleus Accumbens Associated 1, BEN and BTB (POZ) Domain Containing (NACC1) antibody

Antigen

Nucleus Accumbens Associated 1, BEN and BTB (POZ) Domain Containing (NACC1)
Synonyms Nac1, Btbd14b, 2010001H03Rik, 4930511N13Rik, NAC1, BEND8, NAC-1, BTBD14B, FLJ37383, Nac-1
Clonality Polyclonal
Host
Alternatives

Rabbit
Reactivity
Alternatives

Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Dog (Canine)
Application
Alternatives Western Blotting (WB), Immunohistochemistry (IHC)
1 reference available
Catalog no. ABIN183842
Quantity 0.1 mg  (Variants)
Price 251.90 $   Plus shipping costs $45.00
Bulk discount
Shipping to
Availability Will be delivered in 2 to 3 Business Days

anti-Nucleus Accumbens Associated 1, BEN and BTB (POZ) Domain Containing (NACC1) antibody

anti-Nucleus Accumbens Associated 1, BEN and BTB (POZ) Domain Containing (NACC1) antibody (2)

anti-Nucleus Accumbens Associated 1, BEN and BTB (POZ) Domain Containing (NACC1) antibody (3)

Additional Information
Application Details Publications Images Alternatives Variants back to top

Alternative name NACC1 / BTBD14B
Gene ID BTBD14B
UniProt Q96RE7
Immunogen The immunogen for anti-BTBD14B antibody: synthetic peptide directed towards the C terminal of human BTBD14B
Sequence WMPKVKVLKAEDDAYTTFISETGKIEPDMMGVEHGFETAS HEGEAGPSAE
Cross-Reactivity Cow (Bovine), Dog (Canine), Human, Mouse (Murine), Rat (Rattus)
Format Lyophilized
Reconstitution Add 100 µl of distilled water. Final anti-BTBD14B antibody concentration is 1 mg/ml.
Description The function of the Anti-BTBD14B gene has not yet been determined
Characteristics Antigen Size: 527 amino acids
Molecular Weight 57kDa

Application Details
Publications Images Alternatives Variants back to top

Application Notes WB Suggested Anti-BTBD14B Antibody Titration: 5.0ug/ml
Positive Control: HepG2 cell lysate.
Purification Protein A purified
Buffer PBS
Storage (Long Term) For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Storage (Short Term) Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.
Restrictions For Research Use only

Publications
Application Details Images Alternatives Variants back to top

Beausoleil, Jedrychowski, Schwartz et al.: "Large-scale characterization of HeLa cell nuclear phosphoproteins." in: Proceedings of the National Academy of Sciences of the United States of America, Vol. 101, Issue 33, pp. 12130-5, 2004 (PubMed).

Alternatives
Application Details Publications Images Variants back to top

Alternatives for antigen "Nucleus Accumbens Associated 1, BEN and BTB (POZ) Domain Containing (NACC1)", type "Antibodies"
Hosts Rabbit (12), Goat (4), Mouse (4)
Reactivities Human (18), Mouse (Murine) (6), Dog (Canine) (3), Rat (Rattus) (3), Cow (Bovine) (2)
Applications Western Blotting (WB) (18), ELISA (9), Immunohistochemistry (IHC) (5), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) (2), Immunocytochemistry (ICC) (1), Immunofluorescence (IF) (1)
Epitopes C-Term (4), Internal Region (3)